Quick Search

Enter gene name or accession number


Search term: Rv2398c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecysW
Rv numberRv2398c
TypeCDS
FunctionInvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable sulfate-transport integral membrane protein ABC transporter CysW
CommentsRv2398c, (MTCY253.23), len: 272 aa. Probable cysW, sulfate-transport integral membrane protein ABC transporter (see citations below), similar to others e.g. Q9K877|CYSW|BH3129 sulfate ABC transporter (permease) from Bacillus halodurans (287 aa), FASTA scores: opt: 765, E(): 4.1e-40, (43.8% identity in 249 aa overlap); P27370|CYSW_SYNP7 sulfate transport system (permease) protein from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (286 aa), FASTA scores: opt: 757, E(): 1.3e-39, (44.3% identity in 264 aa overlap); Q9I6K9|CYSW|PA0281 sulfate transport protein from Pseudomonas aeruginosa (289 aa), FASTA scores: opt: 753, E(): 2.3e-39, (44.4% identity in 250 aa overlap); P16702|P76534|CYSW_ECOLI sulfate transport system permease from Escherichia coli (291 aa), FASTA scores: opt: 633, E(): 5.7e-32, (38.2% identity in 267 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane component signature. Similarity with integral membrane components of other binding-protein-dependent transport systems and belongs to the CYSTW subfamily.
Molecular mass (Da)29288.7
Isoelectric point9.347
Gene length (bp)819
Protein length272
Location (kb)2694.98


Functional categorycell wall and cell processes


TranscriptomemRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26949812695799-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2398c|cysW
MTSLPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLL
VVAIVVPLNVIFGVTTALVLARNRFRGKGVLQAIIDLPFAVSPVIVGVSLILLWGSAGAL
GFVEQDLGFKIIFGLPGIVLGSMFVTCPFVVREVEPVLHELGTDQEQAAATLGSGWWQTF
WRITLPSIRWGLTYGIVLTVARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGA
YALSTLLMAVSVVVLIVQMVLDARRARAVSEG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71746


Orthologs/Cross-references
CDC1551MT2469
Gene Ontologyplasma membrane
sulfate transport
sulfate transmembrane transporter activity
uptake transmembrane transporter activity
integral to membrane
M. bovisMb2420c
M. lepraeML0617
M. marinumMMAR_3716
M. smegmatisMSMEG_4531
UniProtP71746
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2398c


Expression Data
TBDBRv2398c


Bibliography
Braibant M, Gilot P, Content J,
The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis
FEMS Microbiol Rev (2000) 24(4):449-67
Cited for: Review/Secondary
Wooff E, Michell SL, Gordon SV, Chambers MA, Bardarov S, Jacobs Jr WR, Hewinson RG, Wheeler PR,
Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo
Mol Microbiol (2002) 43(3):653-63
Cited for: Homolog/Secondary/Function
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant