Quick Search

Enter gene name or accession number


Search term: Rv2397c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecysA1
Rv numberRv2397c
Synonym(s)cysA
TypeCDS
FunctionInvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import). Responsible for energy coupling to the transport system.
ProductSulfate-transport ATP-binding protein ABC transporter CysA1
CommentsRv2397c, (MTCY253.24), len: 351 aa. cysA1, sulfate-transport ATP-binding protein ABC transporter (see citations below), similar to other sulfate ABC transporter ATP-binding proteins e.g. P14788|CYSA_SYNP7 from Synechococcus sp. (344 aa), FASTA scores: opt: 1112, E(): 2.6e-56, (54.6% identity in 328 aa overlap); P74548|CYSA_SYNY3 from Synechocystis sp. (355 aa), FASTA scores: opt: 1063, E(): 1.7e-53, (51.9% identity in 343 aa overlap); Q9I6L0|CYSA|PA0280 from Pseudomonas aeruginosa (329 aa), FASTA scores: opt: 987, E(): 3.3e-49, (49.2% identity in 339 aa overlap); etc. Also similar to many ATP-binding proteins from Mycobacterium tuberculosis e.g. Rv2038c, Rv1238, Rv2832c, etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop), and PS00211 ABC transporters family signature. Belongs to the ATP-binding transport protein family (ABC transporters). Note that previously known as cysA.
Molecular mass (Da)37443.8
Isoelectric point9.5917
Gene length (bp)1056
Protein length351
Location (kb)2693.91


Functional categorycell wall and cell processes


ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomemRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26939092694964-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2397c|cysA1
MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGT
ITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQ
VVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRL
HDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST
LNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A4W2


Orthologs/Cross-references
CDC1551MT2468
Enzyme Classification3.6.3.25
Gene OntologyATP binding
plasma membrane
sulfate transport
sulfate transmembrane-transporting ATPase activity
ATP-binding cassette (ABC) transporter complex
M. bovisMb2419c
M. lepraeML0618
M. marinumMMAR_3715
M. smegmatisMSMEG_4530
UniProtP0A4W2
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2397c


Expression Data
TBDBRv2397c


Bibliography
Braibant M, Gilot P, Content J,
The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis
FEMS Microbiol Rev (2000) 24(4):449-67
Cited for: Review/Secondary
Wooff E, Michell SL, Gordon SV, Chambers MA, Bardarov S, Jacobs Jr WR, Hewinson RG, Wheeler PR,
Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo
Mol Microbiol (2002) 43(3):653-63
Cited for: Homolog/Mutant/Function
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant