Quick Search

Enter gene name or accession number


Search term: Rv2396

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namePE_PGRS41
Rv numberRv2396
Synonym(s)aprC
TypeCDS
FunctionFunction unknown
ProductPE-PGRS family protein PE_PGRS41
CommentsRv2396, (MTCY253.25c), len: 361 aa. PE_PGRS41, member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see citation below). Also known as aprC, acid and phagosome regulated protein C, restricted to M. tuberculosis complex (See Abramovitch et al., 2011). Contains PS00583 pfkB family of carbohydrate kinases signature 1. Predicted to be an outer membrane protein (See Song et al., 2008).
Molecular mass (Da)30724.1
Isoelectric point3.8507
Gene length (bp)1086
Protein length361
Location (kb)2692.8


Functional categoryPE/PPE


TranscriptomeDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26927992693884+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2396|PE_PGRS41
MSFLIASPEALAATATYLTGIGSAISAANAVAAAPTTEILAAGTDEVSTAISALFGAHAQ
AYQALSAHVAAFHDQFVHTLTAGAGSYMAAEAAAASPLQALQLELLNAINAPTLALLGRP
LIGDGTDAAPGSGGAGGAGGILIGNGGTGGASDLAGTGRGGVGGAGGAGGLFGIGGAGGG
CGSAVAIGGDGGAGGAGGVFSGGGAGGAGDAIGGSGGAGGTGGLLGGGGGAGGAGGAGGN
GGGASNSASIGGDGGSGGAGGMLYGAGGVGGNGGAAVAIGGDGGAGGRAGAIGNGGDGGN
GGTSNTPGGSGGDGGNGGNAGLIGNGGNGGNAEIVISGGSVAGTGGNGGLLLGFNGTNGL
P
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ79FE6


Orthologs/Cross-references
CDC1551MT2467.1
M. bovisMb2418
UniProtQ79FE6
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2396


Expression Data
TBDBRv2396


Bibliography
Brennan MJ, Delogu G,
The PE multigene family: a 'molecular mantra' for mycobacteria
Trends Microbiol (2002) 10(5):246-9
Cited for: Review
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Song H, Sandie R, Wang Y, Andrade-Navarro MA, Niederweis M,
Identification of outer membrane proteins of Mycobacterium tuberculosis.
Tuberculosis (Edinb) (2008) 88(6):526-44
Cited for: Localization
Abramovitch RB, Rohde KH, Hsu FF, Russell DG,
aprABC: a Mycobacterium tuberculosis complex-specific locus that modulates pH-driven adaptation to the macrophage phagosome.
Mol Microbiol (2011) 80(3):678-94
Cited for: Regulation