Quick Search

Enter gene name or accession number


Search term: Rv2395B

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameaprB
Rv numberRv2395B
TypeCDS
FunctionUnknown
ProductAcid and phagosome regulated protein B AprB
CommentsRv2395B, len: 54 aa. AprB, acid and phagosome regulated protein B, restricted to M. tuberculosis complex.
Molecular mass (Da)5722.64
Isoelectric point4.4811
Gene length (bp)165
Protein length54
Location (kb)2692.55


Functional categoryconserved hypotheticals


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26925512692715+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2395B|aprB
VPGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ8VJJ9


Orthologs/Cross-references
CDC1551MT2467
UniProtQ8VJJ9
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2395B


Expression Data
TBDBRv2395B


Bibliography
Abramovitch RB, Rohde KH, Hsu FF, Russell DG,
aprABC: a Mycobacterium tuberculosis complex-specific locus that modulates pH-driven adaptation to the macrophage phagosome.
Mol Microbiol (2011) 80(3):678-94
Cited for: Regulation