Quick Search

Enter gene name or accession number


Search term: Rv2395A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameaprA
Rv numberRv2395A
TypeCDS
FunctionUnknown
ProductAcid and phagosome regulated protein A AprA
CommentsRv2395A, len: 71 aa. AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7.
Molecular mass (Da)7909.05
Isoelectric point11.589
Gene length (bp)216
Protein length71
Location (kb)2692.22


Functional categoryconserved hypotheticals


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26922242692439+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2395A|aprA
LTMTASVAKVTAARPEPSAAWAEARRRVRQRREDMLRHPAFLSKQLPAEPADDDGVAAVY
DIAIARRRRPA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ8VJK0


Orthologs/Cross-references
CDC1551MT2466
UniProtQ8VJK0
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2395A


Expression Data
TBDBRv2395A


Bibliography
Abramovitch RB, Rohde KH, Hsu FF, Russell DG,
aprABC: a Mycobacterium tuberculosis complex-specific locus that modulates pH-driven adaptation to the macrophage phagosome.
Mol Microbiol (2011) 80(3):678-94
Cited for: Regulation