Quick Search

Enter gene name or accession number


Search term: Rv2395

** Showing annotation for Rv2395. Did you mean: Rv2395A, Rv2395B


General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2395
Rv numberRv2395
TypeCDS
FunctionFunction unknown (possibly involved in transport across the membrane).
ProductProbable conserved integral membrane protein
CommentsRv2395, (MTCY253.26c), len: 667 aa. Probable conserved integral membrane protein, similar to AAK24613|CC2646 oligopeptide transporter/opt family protein from Caulobacter crescentus (666 aa), FASTA scores: opt: 1638, E(): 4.8e-86, (51.0% identity in 658 aa overlap); Q9PIS5|CJ0204 putative integral membrane protein from Campylobacter jejuni (665 aa), FASTA scores: opt: 1484, E(): 2.9e-77, (40.6% identity in 658 aa overlap); and P44016|Y561_HAEIN hypothetical integral membrane protein from Haemophilus influenzae (635 aa), FASTA scores: opt: 1449, E(): 2.8e-75, (42.15% identity in 624 aa overlap).
Molecular mass (Da)68251.6
Isoelectric point9.9373
Gene length (bp)2004
Protein length667
Location (kb)2690.07


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26900722692075+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2395|Rv2395
MSGATVGAREITIRGVVLGALITLVFTAANVYLGLRVGLTFATSIPAAVISMGVLRLFAN
HSVVENNIVQTIASAAGTLSSIIFVLPALLMIGWWSGFPYWTTAAVCALGGILGVMYSIP
LRRALVTGSDLPYPEGVAGAEVLKIGDSAREMEHNRRGIGVIALGAAAAAGYALLASLRV
INNSLSATFRVGSGATMIGASLSLALIGVGHLVGVTVGVAMIVGLAIAFGVMLPIRTAGQ
LPPDGDYAVAVARIFSTDVRFIGAGAIAVAAAWTFLKILGPILRGIADAAVSARTRRRGQ
AVGQTERDIPIHIVAMVVLLSLIPIGWLLADFTDGTPLDDRRPGAIAAGVLLVLVIGLMV
AAVCGYMAGLIGSSNSPISGVGILVVVLAGLLIKTAYGPATGSQIPALVAYTVFTAALVF
GVATISNDNLQDLKTGQLVGATPWKQQVALIIGVLVGSVVMAPILQLMQAGFGFQGAPGA
TANALAAPQAALMSALAKGVFGGSLNWSLVGVGALTGVIAVALDETLAKTTTNLRLPPLA
VGMGMYLSAALTLMIPIGAFLGRIYDSWARWSGDDDERKKRLGVMLATGLIVGESLYGVL
FAVIVATTGKEEPLAMVGDGFRFASQPLGAIVFAGLLAWLYQRTRVTASYRLAAPAGSSK
PLPDLPG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71749


Orthologs/Cross-references
CDC1551MT2465
Gene Ontologytransmembrane transport
M. bovisMb2416
Mb2417
M. marinumMMAR_3714
M. smegmatisMSMEG_1311
UniProtP71749
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2395


Expression Data
TBDBRv2395


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant