Quick Search

Enter gene name or accession number


Search term: Rv2393

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameche1
Rv numberRv2393
TypeCDS
FunctionPossibly involved in inserting FE2+ into sirohydrochlorin to produce siroheme, required for SIRA (Rv2391) function
ProductFerrochelatase Che1
CommentsRv2393, (MTCY253.28c), len: 281 aa. Che1, ferrochelatase (See Pinto et al., 2007). Conserved protein, with some similarity to Q9L2E8|SC7A8.10c putative secreted protein from Streptomyces coelicolor (274 aa), FASTA scores: opt: 407, E(): 2.8e-18, (37% identity in 246 aa overlap); CAC38793|SCI39.05 Conserved hypothetical protein from Streptomyces coelicolor (305 aa), FASTA scores: opt: 394, E(): 2e-17, (35.0% identity in 251 aa overlap); AAK44492|MT0272 Chalcone/stilbene synthase family protein from Mycobacterium tuberculosis (247 aa), FASTA scores: opt: 350, E(): 9.2e-15, (34.0% identity in 235 aa overlap); P95216|Rv0259c|MTCY06A4.03c|Z86089 hypothetical protein from Mycobacterium tuberculosis (247 aa), FASTA scores: opt: 345, E(): 1.9e-14,(33.6% identity in 235 aa overlap).
Molecular mass (Da)29749.3
Isoelectric point11.4257
Gene length (bp)846
Protein length281
Location (kb)2687.13


Functional categoryintermediary metabolism and respiration


ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26871282687973+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2393|che1
VTAPATMQSAAMLRSGAIEAPPATMQSAAMRWGHLPLAEESGTIAPQLVLTAHGSKDPRS
AANARAIAGRLARMRPGLDVRVAFCELNSPNLVDVLNRCRGAAVVTPLLLADAYHARVDI
PAQIASCRVGHRVRQASVLGEDIRLVSALHERLTELGVSPFDHTLGVVVLAIGSSHPAAN
ARTSTVASRLAEGTQWAAVTTAFITRPEASLADATDRLRRHGARRMVIAPWLLAPGILSD
RVRGYAREAGIAMAQPLGAHPMVAATMWDRYRQAVAGRIAA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71751


Orthologs/Cross-references
CDC1551MT2463
Gene Ontologycobalamin biosynthetic process
lyase activity
metal ion binding
M. bovisMb2414
M. marinumMMAR_3418
MMAR_3712
M. smegmatisMSMEG_4529
UniProtP71751
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2393


Expression Data
TBDBRv2393


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Pinto R, Harrison JS, Hsu T, Jacobs WR, Leyh TS,
Sulfite reduction in mycobacteria.
J Bacteriol (2007) 189(18):6714-22
Cited for: Product/Function
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant