Quick Search

Enter gene name or accession number


Search term: Rv2392

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecysH
Rv numberRv2392
TypeCDS
FunctionInvolved in the sulfate activation pathway (at the third step) in the reductive branch of the cysteine biosynthetic pathway. Reduces activated sulfate into sulfite [catalytic activity: 5-phosphoadenosine 3-phosphosulfate + reduced thioredoxin = phosphoadenosine phosphate + oxidized thioredoxin + sulfite].
ProductProbable 3'-phosphoadenosine 5'-phosphosulfate reductase CysH (PAPS reductase, thioredoxin DEP.) (padops reductase) (3'- phosphoadenylylsulfate reductase) (PAPS sulfotransferase)
CommentsRv2392, (MTCY253.29c), len: 254 aa. Probable cysH, 3'-phosphoadenosine 5'-phosphosulfate reductase (see citation below), similar to many e.g. P94498|O34620|CYH1_BACSU|CYSH from Bacillus subtilis (233 aa), FASTA scores: opt: 618, E(): 8.1e-32, (46.5% identity in 202 aa overlap); Q9KCT3|CYSH|BH1486 from Bacillus halodurans (231 aa), FASTA scores: opt: 560, E(): 3.6e-28, (41.3% identity in 230 aa overlap); P56860|CYSH_DEIRA from Deinococcus radiodurans (255 aa), FASTA scores: opt: 489, E(): 1.1e-23, (44.7% identity in 190 aa overlap); etc. Belongs to the PAPS reductase family and CYSH subfamily. Note that operon cysA-cysW-cysT-subI, probably involved in sulfate transport, is near this putative ORF.
Molecular mass (Da)27422.9
Isoelectric point4.9994
Gene length (bp)765
Protein length254
Location (kb)2686.37


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26863672687131+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2392|cysH
MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGVSGHRGWTTCN
YVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVTPEHT
VAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLVSFD
ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGR
WQGLAKTECGLHAS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65668


Orthologs/Cross-references
CDC1551MT2462
Enzyme Classification1.8.4.8
Gene Ontologyphosphoadenylyl-sulfate reductase (thioredoxin) activity
cytoplasm
transferase activity
cysteine biosynthetic process
sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
oxidation reduction
M. bovisMb2413
M. marinumMMAR_3417
MMAR_3711
M. smegmatisMSMEG_4528
UniProtP65668
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2392


Expression Data
TBDBRv2392


Bibliography
Wooff E, Michell SL, Gordon SV, Chambers MA, Bardarov S, Jacobs Jr WR, Hewinson RG, Wheeler PR,
Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo
Mol Microbiol (2002) 43(3):653-63
Cited for: Secondary/Homolog/Function
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant