Quick Search

Enter gene name or accession number


Search term: Rv2391

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namesirA
Rv numberRv2391
TypeCDS
FunctionCatalyzes the reduction of sulfite to sulfide, in the biosynthesis of sulfur-containing amino acids and co-factors
ProductFerredoxin-dependent sulfite reductase SirA
CommentsRv2391, (MTCY253.30c), len: 563 aa. SirA, ferredoxin-dependent sulfite reductase (See Schnell et al., 2005). Previously annotated as nirA. Similar to e.g. CAC33947|SCBAC1A6.26c Putative nitrite/sulphite reductase from Streptomyces coelicolor (565 aa), FASTA scores: opt: 2335, E(): 1.2e-137, (60.1% identity in 567 aa overlap); Q9RZD6|DRA0013 ferredoxin-nitrite reductase from Deinococcus radiodurans (563 aa), FASTA scores: opt: 1141, E(): 2.2e-63, (39.6% identity in 533 aa overlap); Q59656|NIRA (D31732|PEENIRNRT_1) ferredoxin-dependent nitrite reductase from Plectonema boryanum (654 aa) (see Suzuki & Kikuchi 1995), FASTA scores: opt: 805, E(): 1.9e-42, (31.7% identity in 517 aa overlap); Q55366|NIRA|SLR0898 ferredoxin-nitrite reductase from Synechocystis sp. strain PCC 6803 (502 aa), FASTA scores: opt: 799, E(): 3.7e-42, (32.3% identity in 517 aa overlap); etc. Highly similar (only in N-terminal part because shortened protein (fragment) owing to an IS900 insertion) to Q9K541|NIRA nitrate reductase (fragment) from Mycobacterium paratuberculosis (198 aa), FASTA scores: opt: 798, E(): 2.1e-42, (65.4% identity in 182 aa overlap) (see Bull et al., 2000).
Molecular mass (Da)62997.5
Isoelectric point6.407
Gene length (bp)1692
Protein length563
Location (kb)2684.68


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomeDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003).. Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26846792686370+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2391|sirA
MSAKENPQMTTARPAKARNEGQWALGHREPLNANEELKKAGNPLDVRERIENIYAKQGFD
SIDKTDLRGRFRWWGLYTQREQGYDGTWTGDDNIDKLEAKYFMMRVRCDGGALSAAALRT
LGQISTEFARDTADISDRQNVQYHWIEVENVPEIWRRLDDVGLQTTEACGDCPRVVLGSP
LAGESLDEVLDPTWAIEEIVRRYIGKPDFADLPRKYKTAISGLQDVAHEINDVAFIGVNH
PEHGPGLDLWVGGGLSTNPMLAQRVGAWVPLGEVPEVWAAVTSVFRDYGYRRLRAKARLK
FLIKDWGIAKFREVLETEYLKRPLIDGPAPEPVKHPIDHVGVQRLKNGLNAVGVAPIAGR
VSGTILTAVADLMARAGSDRIRFTPYQKLVILDIPDALLDDLIAGLDALGLQSRPSHWRR
NLMACSGIEFCKLSFAETRVRAQHLVPELERRLEDINSQLDVPITVNINGCPNSCARIQI
ADIGFKGQMIDDGHGGSVEGFQVHLGGHLGLDAGFGRKLRQHKVTSDELGDYIDRVVRNF
VKHRSEGERFAQWVIRAEEDDLR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP71753
Protein Data Bank1ZJ8 1ZJ9


Orthologs/Cross-references
CDC1551MT2461
Enzyme Classification1.8.7.1
Gene Ontologyheme binding
sulfite reductase (ferredoxin) activity
4 iron, 4 sulfur cluster binding
oxidation reduction
M. bovisMb2412
M. marinumMMAR_3710
M. smegmatisMSMEG_4527
UniProtP71753
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2391


Expression Data
TBDBRv2391


Bibliography
Bull TJ, Hermon-Taylor J, Pavlik I, El -Zaatari F, Tizard M,
Characterization of IS900 loci in Mycobacterium avium subsp. paratuberculosis and development of multiplex PCR typing
Microbiology (2000) 146(Pt 9):2185-97
Cited for: Sequence
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant
Schnell R, Sandalova T, Hellman U, Lindqvist Y, Schneider G,
Siroheme- and [Fe4-S4]-dependent NirA from Mycobacterium tuberculosis is a sulfite reductase with a covalent Cys-Tyr bond in the active site.
J Biol Chem (2005) 280(29):27319-28
Cited for: Product/Function
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Suzuki I, Kikuchi H, Nakanishi S, Fujita Y, Sugiyama T, Omata T,
A novel nitrite reductase gene from the cyanobacterium Plectonema boryanum
J Bacteriol (1995) 177(21):6137-43
Cited for: Homolog/Mutant/Function