Quick Search

Enter gene name or accession number


Search term: Rv2390c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2390c
Rv numberRv2390c
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2390c, (MTCY253.31), len: 185 aa. Conserved hypothetical protein, similar to other Mycobacterium tuberculosis proteins Q11032|YD62_MYCTU|MTCY02B10.26c|Rv1362c hypothetical 23.5 kDa protein (220 aa), FASTA scores: opt: 223, E(): 2.1e-07, (27.4% identity in 190 aa overlap); and Q11033|YD63_MYCTU|MTCY02B10.27c|Rv1363c hypothetical 28.3 kDa protein (261 aa), FASTA scores: opt: 238, E(): 2.7e-08, (27.6% identity in 163 aa overlap).
Molecular mass (Da)19856.7
Isoelectric point10.1758
Gene length (bp)558
Protein length185
Location (kb)2683.71


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the Rv1404 regulon (See Golby et al., 2008).


Coordinates
TypeStartEndOrientation
CDS26837092684266-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2390c|Rv2390c
MAIFGRGHGASEPGGTGEPAETPGRGRLTRSVIGWVGAVAVVVSLAGSGWCGWVLFEKHQ
TDVAAGQALQAARSYVVKLATMDCERIDHNMRDILEGSTGEFKDKYGKSSAHLRQLLADN
RVATHGTVVAASVKSATTNKVVVLMFIDQSVSNRNSPTPQIDRSRIKVIMDKVNGRWLAS
KVELL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2459
M. bovisMb2411c
M. marinumMMAR_0161
M. smegmatisMSMEG_1149
UniProtP71754
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2390c


Expression Data
TBDBRv2390c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG, Gordon SV,
Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation.
Microbiology (2008) 154(Pt 4):1059-67
Cited for: Regulon
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function