Quick Search

Enter gene name or accession number


Search term: Rv2389c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namerpfD
Rv numberRv2389c
TypeCDS
FunctionPromotes the resuscitation and growth of dormant, nongrowing cell. Could also stimulates the growth of several other high G+C gram+ organisms, e.g. Mycobacterium avium, Mycobacterium bovis (BCG), Mycobacterium kansasii, Mycobacterium smegmatis.
ProductProbable resuscitation-promoting factor RpfD
CommentsRv2389c, (MTCY253.32), len: 154 aa. Probable rpfD, resuscitation-promoting factor. Possible autocrine and/or paracrine bacterial growth factor or cytokine (see citation below). Similar to others from Mycobacterium tuberculosis e.g. O07747|Rv1884c|MTCY180.34|RPFC probable resuscitation-promoting factor from Mycobacterium tuberculosis (176 aa), FASTA scores: opt: 382, E(): 2.3e-17, (55.45% identity in 101 aa overlap); etc. Also similarity with Q9CBF8|ML2030 hypothetical protein from Mycobacterium leprae (157 aa), FASTA scores: opt: 397, E(): 2.4e-18, (47.95% identity in 121 aa overlap); Q9F2Q2|SCE41.06c putative secreted protein from Streptomyces coelicolor (244 aa), FASTA scores: opt: 341, E(): 1.1e-14, (40.45% identity in 131 aa overlap); and O86308|Z96935|MLRPF_1 RPF protein precursor from Micrococcus luteus (220 aa), FASTA scores: opt: 301, E(): 3.6e-12, (39.4% identity in 132 aa overlap). Contains a secretory signal sequence in N-terminus. Supposed acts at very low concentration. Predicted possible vaccine candidate (See Zvi et al., 2008).
Molecular mass (Da)15678.5
Isoelectric point4.2397
Gene length (bp)465
Protein length154
Location (kb)2683.25


Functional categorycell wall and cell processes


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Non essential gene by specialized transduction in M. tuberculosis Erdman; growth and persistence of mutant in mice are not attenuated (See Tufariello et al., 2004). M. tuberculosis H37Rv rpfACBD, rpfACBE, rpfACDE, and rpfACBED mutants show no growth defects in broth culture; growth of rpfACBD and rpfACBE mutants in human peripheral blood mononuclear cells is unaffected but growth in B6D2/F1 mice is attenuated (See Kana et al., 2008). Check for mutants available at TARGET website
RegulonPredicted to be in the Rv1404 regulon (See Golby et al., 2008).


Coordinates
TypeStartEndOrientation
CDS26832482683712-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2389c|rpfD
MTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKADDIDWDAIAQC
ESGGNWAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPK
CSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71755


Orthologs/Cross-references
CDC1551MT2458
Gene Ontologyextracellular region
M. bovisMb2410c
UniProtP71755
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2389c


Expression Data
TBDBRv2389c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tufariello JM, Jacobs WR, Chan J,
Individual Mycobacterium tuberculosis resuscitation-promoting factor homologues are dispensable for growth in vitro and in vivo.
Infect Immun (2004) 72(1):515-26
Cited for: Mutant
Gao H, Bai Y, Xue Y, Wang L, Fan A, Ding X, Xu Z,
Expression, purification, and characterization of soluble RpfD with high bioactivity as a recombinant protein in Mycobacterium vaccae.
Protein Expr Purif (2007) 55(1):112-8
Cited for: Biochemistry
Kana BD, Gordhan BG, Downing KJ, Sung N, Vostroktunova G, Machowski EE, Tsenova L, Young M, Kaprelyants A, Kaplan G, Mizrahi V,
The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro.
Mol Microbiol (2008) 67(3):672-84
Cited for: Mutant
Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG, Gordon SV,
Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation.
Microbiology (2008) 154(Pt 4):1059-67
Cited for: Regulon
Zvi A, Ariel N, Fulkerson J, Sadoff JC, Shafferman A,
Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses.
BMC Med Genomics (2008) 1:18
Cited for: Immunology
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mukamolova GV, Kaprelyants AS, Young DI, Young M, Kell DB,
A bacterial cytokine
Proc Natl Acad Sci U S A (1998) 95(15):8916-21
Cited for: Secondary/Function