Quick Search

Enter gene name or accession number


Search term: Rv2388c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehemN
Rv numberRv2388c
TypeCDS
FunctionInvolved in porphyrin biosynthesis. Anaerobic transformation of coproporphyrinogen-III into protoporphyrinogen-IX.
ProductProbable oxygen-independent coproporphyrinogen III oxidase HemN (coproporphyrinogenase) (coprogen oxidase)
CommentsRv2388c, (MTCY253.33), len: 375 aa. Probable hemN, oxygen-independent coproporphyrinogen III oxidases, highly similar to many putative oxygen-independent coproporphyrinogen III oxidases e.g. Q9RDD2|SCC77.26 from Streptomyces coelicolor (435 aa), FASTA scores: opt: 1358, E(): 1.5e-76, (56.55% identity in 382 aa overlap); BAB51237|MLR4627 from Rhizobium loti (Mesorhizobium loti) (392 aa), FASTA scores: opt: 696, E(): 1.1e-35, (36.8% identity in 383 aa overlap); Q9KUR0|VC0455 from Vibrio cholerae (391 aa), FASTA scores: opt: 691, 2.2e-35, (32.65% identity in 386 aa overlap); P54304|HEMN_BACSU from Bacillus subtilis (366 aa), FASTA scores: opt: 668 , E(): 5.6e-34; (34.9% identity in 327 aa overlap); etc. Equivalent to AAK46752 from Mycobacterium tuberculosis strain CDC1551 (390 aa) but shorter 375 aa. Belongs to the anaerobic coproporphyrinogen III oxidase family.
Molecular mass (Da)40333.6
Isoelectric point5.5388
Gene length (bp)1128
Protein length375
Location (kb)2682.01


Functional categoryintermediary metabolism and respiration


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26820152683142-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2388c|hemN
MPGQPFGVYLHVPFCLTRCGYCDFNTYTPAQLGGVSPDRWLLALRAELELAAAKLDAPTV
HTVYVGGGTPSLLGGERLATLLDMVRDHFVLAPDAEVSTEANPESTWPEFFATIRAAGYT
RVSLGMQSVAPRVLATLDRVHSPGRAAAAATEAIAEGFTHVNLDLIYGTPGESDDDLVRS
VDAAVQAGVDHVSAYALVVEHGTALARRVRRGELAAPDDDVLAHRYELVDARLSAAGFAW
YEVSNWCRPGGECRHNLGYWDGGQWWGAGPGAHGYIGVTRWWNVKHPNTYAEILAGATLP
VAGFEQLGADALHTEDVLLKVRLRQGLPLARLGAAERERAEAVLADGLLDYHGDRLVLTG
RGRLLADAVVRTLLG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71756


Orthologs/Cross-references
CDC1551MT2457
Enzyme Classification1.3.99.22
Gene Ontologycoproporphyrinogen oxidase activity
cytoplasm
porphyrin biosynthetic process
metal ion binding
4 iron, 4 sulfur cluster binding
coproporphyrinogen dehydrogenase activity
oxidation reduction
M. bovisMb2409c
M. marinumMMAR_3709
M. smegmatisMSMEG_4525
UniProtP71756
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2388c


Expression Data
TBDBRv2388c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant