 |  |
| To navigate upstream or downstream, click on the first or last gene |
| Functional category | intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutation | slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation |
| RBS | 2512523 | 2512530 | + | CDS | 2512539 | 2515244 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv|Rv2241|aceE VASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAIPALTSTDYVN TIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGF NHFFRGKSHPGGGDQVFIQGHASPGIYARAFLEGRLTAEQLDGFRQEHSHVGGGLPSYPH PRLMPDFWEFPTVSMGLGPLNAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESR GLAHVGALEGLDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVENMSDQDIWNL KRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKHFEGRNATHQMKKLTLEDLKE FRDTQRIPVSDAQLEENPYLPPYYHPGLNAPEIRYMLDRRRALGGFVPERRTKSKALTLP GRDIYAPLKKGSGHQEVATTMATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSL KIYNRNGQLYTAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHSLLLAATNPAV VAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEPYVQPPEPENFDPEGVLRGIY RYHAATEQRTNKAQILASGVAMPAALRAAQMLAAEWDVAADVWSVTSWGELNRDGVAIET EKLRHPDRPAGVPYVTRALENARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSD TRPAARRYFNTDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG A | ||
| Blastp: Pre-computed results | ||
| TransMembrane prediction using Hidden Markov Models: TMHMM | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Q10504 | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT2301 | |
| Enzyme Classification | 1.2.4.1 | |
| Gene Ontology | pyruvate dehydrogenase (acetyl-transferring) activity glycolysis oxidation reduction | |
| M. bovis | Mb2265 | |
| M. leprae | ML1651 | |
| M. marinum | MMAR_3334 | |
| M. smegmatis | MSMEG_4323 | |
| UniProt | Q10504 | |
| Multiple Sequences Alignment: between orthologs | ||
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv2241 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv2241 | |
| Bibliography | ||
|---|---|---|
| Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P, Towards the proteome of Mycobacterium tuberculosis Electrophoresis (2000) 21(17):3740-56 Cited for: Proteomics | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 Cited for: Mutant | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 Cited for: Proteomics | ||
| Sassetti CM, Rubin EJ, Genetic requirements for mycobacterial survival during infection. Proc Natl Acad Sci U S A (2003) 100(22):12989-94 Cited for: Mutant | ||
| Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X, Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol Biol Cell (2005) 16(1):396-404 Cited for: Proteomics | ||
| Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG, Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J Proteome Res (2005) 4(3):855-61 Cited for: Proteomics | ||
| Tian J, Bryk R, Shi S, Erdjument-Bromage H, Tempst P, Nathan C, Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol Microbiol (2005) 57(3):859-68 Cited for: Function | ||
| Malen H, Berven FS, Fladmark KE, Wiker HG, Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics (2007) 7(10):1702-18 Cited for: Proteomics | ||
| Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG, Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. BMC Microbiol (2010) 10:132 Cited for: Proteomics | ||
| Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM, Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. PLoS One (2010) 5(11):e13938 Cited for: Proteomics | ||
| de Souza GA, Leversen NA, Malen H, Wiker HG, Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. J Proteomics (2011) 75(2):502-10 Cited for: Proteomics | ||
| Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM, High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. PLoS Pathog (2011) 7(9):e1002251 Cited for: Mutant | ||