Quick Search

Enter gene name or accession number


Search term: Rv2237A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2237A
Rv numberRv2237A
TypeCDS
FunctionUnknown
ProductConserved protein
CommentsRv2237A, len: 78 aa. Conserved protein.
Molecular mass (Da)8475.68
Isoelectric point9.2708
Gene length (bp)237
Protein length78
Location (kb)2510.35


Functional categoryconserved hypotheticals


ProteomicsIdentified in the membrane fraction and whole cell lysates but not culture filtrate of M. tuberculosis H37Rv (See de Souza et al., 2011). Identified in cell lysates and/or culture filtrates of M. tuberculosis H37Rv (See Kelkar et al., 2011).
Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS25103512510587-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2237A|Rv2237A
VLRCRRGAGYGSVVVVGERPGFQSDSAARQTAPPVRPMTSDQLPATKADLYAAVDAMRAD
MRELLEQISTLIREATQK
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2297
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2237A


Expression Data
TBDBRv2237A


Bibliography
de Souza GA, Arntzen MO, Fortuin S, Schurch AC, Malen H, McEvoy CR, van Soolingen D, Thiede B, Warren RM, Wiker HG,
Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database.
Mol Cell Proteomics (2011) 10(1):M110.002527
Cited for: Proteomics/Sequence
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence