Quick Search

Enter gene name or accession number


Search term: Rv2237

** Showing annotation for Rv2237. Did you mean: Rv2237A


General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2237
Rv numberRv2237
TypeCDS
FunctionUnknown
ProductConserved protein
CommentsRv2237, (MTCY427.18), len: 255 aa. Conserved protein. Similar to Mycobacterium tuberculosis hypothetical proteins Rv0276, Rv0826, Rv1645c. FASTA score: Rv0276 gp|AL021930|MTV035_4 (306 aa) opt: 874, E(): 0; 49.6% identity in 282 aa overlap
Molecular mass (Da)29067.5
Isoelectric point9.6344
Gene length (bp)768
Protein length255
Location (kb)2509.49


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: cell wall and cell processes (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS25093602509363+
CDS25094892510256+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2237|Rv2237
MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI
RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY
QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA
VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY
LWDMRFRARHGRRIV
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64957


Orthologs/Cross-references
CDC1551MT2296
Gene Ontologyplasma membrane
integral to membrane
M. bovisMb2261
M. marinumMMAR_3312
M. smegmatisMSMEG_3590
MSMEG_6722
UniProtP64957
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2237


Expression Data
TBDBRv2237


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function