Quick Search

Enter gene name or accession number


Search term: Rv2236c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecobD
Rv numberRv2236c
TypeCDS
FunctionInvolved in cobalamin biosynthesis, in the conversion of cobyric acid to cobinamide.
ProductProbable cobalamin biosynthesis transmembrane protein CobD
CommentsRv2236c, (MTCY427.17c), len: 313 aa. Probable cobD, cobalamin biosynthesis transmembrane protein, similar to S52223 Rhodobacter capsulatus 945 protein BluD (39.0% identity in 287 aa overlap) involved in cobinamide synthesis, and to COBD_PSEDE Pseudomonas dentrificans cobD protein (37.5% identity in 269 aa overlap), also CBIB_SALTY Salmonella typhimurum cbiB protein (35.5% identity in 304 aa overlap).
Molecular mass (Da)32944.1
Isoelectric point11.4485
Gene length (bp)942
Protein length313
Location (kb)2508.43


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS25084342509375-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2236c|cobD
VFASTWQTRAVGVLIGCLLDVVFGDPKRGHPVALFGRAAAKLEQITYRDGRVAGAVHVGL
LVGAVGLLGAALQRLPGRSWPVAATATATWAALGGTSLARTGRQISDLLERDDVEAARRL
LPSLCGRDPAQLGGPGLTRAALESVAENTADAQVVPLLWAASSGVPAVLGYRAINTLDSM
IGYRSPRYLRFGWAAARLDDWANYVGARATAVLVVICAPVVGGSPRGAVRAWRRDAARHP
SPNAGVVEAAFAGALDVRLGGPTRYHHELQIRPTLGDGRSPKVADLRRAVVLSRVVQAGA
AVLAVMLVYRRRP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ10518


Orthologs/Cross-references
CDC1551MT2295
Gene Ontologyplasma membrane
cobalamin biosynthetic process
cobalamin-transporting ATPase activity
integral to membrane
M. bovisMb2260c
M. lepraeML1645
M. marinumMMAR_3311
M. smegmatisMSMEG_4310
UniProtQ10518
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2236c


Expression Data
TBDBRv2236c


Bibliography
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics