Quick Search

Enter gene name or accession number


Search term: Rv2235

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2235
Rv numberRv2235
TypeCDS
FunctionFunction unknown: may be involved in the ability to survive in macrophages.
ProductProbable conserved transmembrane protein
CommentsRv2235, (MTCY427.16), len: 271 aa. Probable conserved transmembrane protein (see Miller & Shinnick 2001); hydrophobic regions near N- and C-terminus. Similar to conserved membrane proteins in other Actinomycetes. Equivalent to Mycobacterium leprae. ML1644 (270 aa). FASTA scores: opt: 1357, E(): 1.2e-72; 74.170% identity in 271 aa overlap T44717|3150235|CAA19213.1|AL023635 13093419|CAC30595.1|AL583922. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)29762.4
Isoelectric point9.9505
Gene length (bp)816
Protein length271
Location (kb)2507.64


Functional categorycell wall and cell processes


ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomemRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS25076262507628+
CDS25076372508452+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2235|Rv2235
MPRLAFLLRPGWLALALVVVAFTYLCFTVLAPWQLGKNAKTSRENQQIRYSLDTPPVPLK
TLLPQQDSSAPDAQWRRVTATGQYLPDVQVLARLRVVEGDQAFEVLAPFVVDGGPTVLVD
RGYVRPQVGSHVPPIPRLPVQTVTITARLRDSEPSVAGKDPFVRDGFQQVYSINTGQVAA
LTGVQLAGSYLQLIEDQPGGLGVLGVPHLDPGPFLSYGIQWISFGILAPIGLGYFAYAEI
RARRREKAGSPPPDKPMTVEQKLADRYGRRR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP66883


Orthologs/Cross-references
CDC1551MT2294
Gene Ontologyplasma membrane
integral to membrane
M. bovisMb2259
M. lepraeML1644
M. marinumMMAR_3310
M. smegmatisMSMEG_4311
UniProtP66883
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2235


Expression Data
TBDBRv2235


Bibliography
Miller BH, Shinnick TM,
Identification of two Mycobacterium tuberculosis H37Rv ORFs involved in resistance to killing by human macrophages
BMC Microbiol (2001) 1(1):26
Cited for: Product
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant