Quick Search

Enter gene name or accession number


Search term: Rv2232

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameptkA
Rv numberRv2232
TypeCDS
FunctionInvolved in signal transduction (via phosphorylation). Can phosphorylate PTPA|Rv2234 and the peptide substrate myelin basic protein (MBP) [catalytic activity: ATP + a protein = ADP + a phosphoprotein]
ProductProtein tyrosine kinase transcriptional regulatory protein PtkA
CommentsRv2232, (MTCY427.13), len: 291 aa. PtkA, protein tyrosine kinase, similar to members of haloacid dehalogenase-like family from several bacteria and to putative phosphatases e.g. Q9I767 and AAK78398. Contains N-terminal extension. FASTA scores: Q9I767 hypothetical protein PA0065 (221 aa) opt: 439 E(): 3.2e-18; 38.679% identity (40.196% ungapped) in 212 aa overlap; >>tr|AAK78398 Predicted phosphatase, had family (216 aa) opt: 427, E(): 1.5e-17; 34.762% identity (35.437% ungapped) in 210 aa overlap. Replaces previous Rv2232 and Rv2233. Predicted to be an outer membrane protein (See Song et al., 2008).
Molecular mass (Da)30662.3
Isoelectric point7.1385
Gene length (bp)876
Protein length291
Location (kb)2506.28


Functional categoryregulatory proteins


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS25062702506272+
CDS25062782507153+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2232|ptkA
VSSPRERRPASQAPRLSRRPPAHQTSRSSPDTTAPTGSGLSNRFVNDNGIVTDTTASGTN
CPPPPRAAARRASSPGESPQLVIFDLDGTLTDSARGIVSSFRHALNHIGAPVPEGDLATH
IVGPPMHETLRAMGLGESAEEAIVAYRADYSARGWAMNSLFDGIGPLLADLRTAGVRLAV
ATSKAEPTARRILRHFGIEQHFEVIAGASTDGSRGSKVDVLAHALAQLRPLPERLVMVGD
RSHDVDGAAAHGIDTVVVGWGYGRADFIDKTSTTVVTHAATIDELREALGV
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP68911


Orthologs/Cross-references
CDC1551MT2292
Gene Ontologymetabolic process
phosphoglycolate phosphatase activity
M. bovisMb2257
M. lepraeML1641
M. marinumMMAR_3308
M. smegmatisMSMEG_4308
UniProtP68911
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2232


Expression Data
TBDBRv2232


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Song H, Sandie R, Wang Y, Andrade-Navarro MA, Niederweis M,
Identification of outer membrane proteins of Mycobacterium tuberculosis.
Tuberculosis (Edinb) (2008) 88(6):526-44
Cited for: Localization
Bach H, Wong D, Av-Gay Y,
Mycobacterium tuberculosis PtkA is a novel protein tyrosine kinase whose substrate is PtpA.
Biochem J (2009) 420(2):155-60
Cited for: Biochemistry/Product
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant