Quick Search

Enter gene name or accession number


Search term: Rv2231c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecobC
Rv numberRv2231c
TypeCDS
FunctionInvolved in cobalamin biosynthesis
ProductPossible aminotransferase CobC
CommentsRv2231c, (MTCY427.12c), len: 364 aa. Possible cobC, aminotransferase. Note that initiation codon uncertain. Similar to CobC aminotransferases e.g. sp|P21633|COBC_PSEDE COBC protein (333 aa) opt: 277, E(): 1.7e-11; 28.8% identity in 313 aa overlap and also to e.g. SW:HIS8_ECOLI P06986 histidinol-phosphate aminotransferase (27.0% identity in 289 aa overlap), contains PS00105 aminotransferases class-I pyridoxal-phosphate attachment site. Real Mycobacterium tuberculosis histidinol-phosphate aminotransferase, hisC, is Rv1600 (MTCY336.04c).
Molecular mass (Da)38904.7
Isoelectric point6.5893
Gene length (bp)1095
Protein length364
Location (kb)2504.6


Functional categoryintermediary metabolism and respiration


Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS25046052505699-
RBS25046152504619-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2231c|cobC
VLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGVLDFAVNVRHDRPPEWLVRQL
AALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGAAEGFALLHNLSPVRAAIVVP
AFTEPAIALSAAGITAHHVVLKPPFVLDTAHVPDDADLVVVGNPTNPTSVLHLREQLLEL
RRPGRILVVDEAFADWVPGEPQSLADDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLA
RLTVQRAHWPLGTLQLTAIAACCAPRAVAAAAADAVRLTALRAEMVAGLRSVGAEVVDGA
APFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVLVAAIAEWAKR
GGRR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63500


Orthologs/Cross-references
CDC1551MT2290
Enzyme Classification2.6.1.-
Gene Ontologycytoplasm
transaminase activity
biosynthetic process
pyridoxal phosphate binding
M. bovisMb2256c
M. lepraeML1640
M. marinumMMAR_3307
UniProtP63500
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2231c


Expression Data
TBDBRv2231c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant