Quick Search

Enter gene name or accession number


Search term: Rv2231B

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namevapB16
Rv numberRv2231B
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB16
CommentsRv2231B, len: 58 aa. Possible vapB16, antitoxin, part of toxin-antitoxin (TA) operon with Rv2231A (See Pandey and Gerdes, 2005).
Molecular mass (Da)6490.67
Isoelectric point11.2008
Gene length (bp)177
Protein length58
Location (kb)2506.21


Functional categoryvirulence, detoxification, adaptation


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS25062072506383-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2231B|vapB16
LALWYQAMIAKFGEQVVDAKVWAPAKRVGVHEAKTRLSELLRLVYGGQRLRLPAAASR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
UniProtP0CW31
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2231B


Expression Data
TBDBRv2231B


Bibliography
Pandey DP, Gerdes K,
Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes.
Nucleic Acids Res (2005) 33(3):966-76
Cited for: Homology
Gupta A,
Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis.
FEMS Microbiol Lett (2009) 290(1):45-53
Cited for: Function
Ramage HR, Connolly LE, Cox JS,
Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution.
PLoS Genet (2009) 5(12):e1000767
Cited for: Function