Quick Search

Enter gene name or accession number


Search term: Rv2231A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namevapC16
Rv numberRv2231A
TypeCDS
FunctionUnknown
ProductPossible toxin VapC16
CommentsRv2231A, len: 141 aa. Possible vapC16, toxin, part of toxin-antitoxin (TA) operon with Rv2231B (See Pandey and Gerdes, 2005). Nucleotide position 2505919 in the genome sequence has been corrected, A:G resulting in A81A.
Molecular mass (Da)15424.5
Isoelectric point9.2402
Gene length (bp)426
Protein length141
Location (kb)2505.74


Functional categoryvirulence, detoxification, adaptation


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS25057362506161-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2231A|vapC16
LTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAA
SAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCA
HRPGTAAWPDDHHRRRPVSCL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
UniProtP0CV93
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2231A


Expression Data
TBDBRv2231A


Bibliography
Pandey DP, Gerdes K,
Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes.
Nucleic Acids Res (2005) 33(3):966-76
Cited for: Homology
Gupta A,
Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis.
FEMS Microbiol Lett (2009) 290(1):45-53
Cited for: Function
Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G, Archer JA,
Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints.
PLoS One (2009) 4(10):e7407
Cited for: Sequence
Ramage HR, Connolly LE, Cox JS,
Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution.
PLoS Genet (2009) 5(12):e1000767
Cited for: Function
Ioerger TR, Feng Y, Ganesula K, Chen X, Dobos KM, Fortune S, Jacobs WR Jr, Mizrahi V, Parish T, Rubin E, Sassetti C, Sacchettini JC,
Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories.
J Bacteriol (2010) 192(14):3645-53
Cited for: Sequence