Quick Search

Enter gene name or accession number


Search term: Rv2196

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameqcrB
Rv numberRv2196
TypeCDS
FunctionRespiration
ProductProbable ubiquinol-cytochrome C reductase QcrB (cytochrome B subunit)
CommentsRv2196, (MTCY190.07), len: 549 aa. Probable qcrB, Ubiquinol-cytochrome C reductase cytochrome B subunit (cytB), integral membrane protein, low similarity in amino-terminal half to cytochrome b subunits, highly similar at C-terminus to SW:12KD_MYCLE P15878 12 KD protein PIR:S08427 (86.9% identity in 153 aa overlap). FASTA scores: sp|Q45658|QCRB_BACST menaquinol-cytochrome C reductase (224 aa) opt: 341, E(): 6.8e-15; 28.0% identity in 207 aa overlap
Molecular mass (Da)61014.4
Isoelectric point8.7493
Gene length (bp)1650
Protein length549
Location (kb)2459.68


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24596782461327+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2196|qcrB
MSPKLSPPNIGEVLARQAEDIDTRYHPSAALRRQLNKVFPTHWSFLLGEIALYSFVVLLI
TGVYLTLFFDPSMVDVTYNGVYQPLRGVEMSRAYQSALDISFEVRGGLFVRQIHHWAALM
FAAAIMVHLARIFFTGAFRRPRETNWVIGSLLLILAMFEGYFGYSLPDDLLSGLGLRAAL
SSITLGMPVIGTWLHWALFGGDFPGTILIPRLYALHILLLPGIILALIGLHLALVWFQKH
TQFPGPGRTEHNVVGVRVMPVFAFKSGAFFAAIVGVLGLMGGLLQINPIWNLGPYKPSQV
SAGSQPDFYMMWTEGLARIWPPWEFYFWHHTIPAPVWVAVIMGLVFVLLPAYPFLEKRFT
GDYAHHNLLQRPRDVPVRTAIGAMAIAFYMVLTLAAMNDIIALKFHISLNATTWIGRIGM
VILPPFVYFITYRWCIGLQRSDRSVLEHGVETGIIKRLPHGAYIELHQPLGPVDEHGHPI
PLQYQGAPLPKRMNKLGSAGSPGSGSFLFADSAAEDAALREAGHAAEQRALAALREHQDS
IMGSPDGEH
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2252
Gene Ontologyplasma membrane
transport
electron carrier activity
integral to membrane
oxidoreductase activity
respiratory electron transport chain
metal ion binding
M. bovisMb2219
M. lepraeML0879
M. marinumMMAR_3240
M. smegmatisMSMEG_4263
UniProtP63885
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2196


Expression Data
TBDBRv2196


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant