Quick Search

Enter gene name or accession number


Search term: Rv2193

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namectaE
Rv numberRv2193
TypeCDS
FunctionThought to be involved in aerobic respiration.
ProductProbable cytochrome C oxidase (subunit III) CtaE
CommentsRv2193, (MTCY190.04), len: 203 aa. Probable ctaE, cytochrome c oxidase polypeptide III (cox3), with strong similarity to others e.g. COX3_SYNY3|Q06475 (29.8% identity in 225 aa overlap).
Molecular mass (Da)22388.1
Isoelectric point9.5331
Gene length (bp)612
Protein length203
Location (kb)2456.9


Functional categoryintermediary metabolism and respiration


ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomemRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see citation below).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24569012457512+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2193|ctaE
VTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAFYFSARAQAGGNWPP
PPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYE
YRNLMSHGTSIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIV
VSYYWHFVDIVWIALFTVIYFIR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63856


Orthologs/Cross-references
CDC1551MT2249
Enzyme Classification1.9.3.1
Gene Ontologycytochrome-c oxidase activity
plasma membrane
mitochondrial electron transport, cytochrome c to oxygen
integral to membrane
M. bovisMb2216
M. lepraeML0882
M. marinumMMAR_3237
M. smegmatisMSMEG_4260
UniProtP63856
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2193


Expression Data
TBDBRv2193


Bibliography
Stewart GR, Wernisch L, Stabler R, Mangan JA, Hinds J, Laing KG, Young DB, Butcher PD,
Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays
Microbiology (2002) 148(Pt 10):3129-3138
Cited for: Transcriptome/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant