Quick Search

Enter gene name or accession number


Search term: Rv2191

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2191
Rv numberRv2191
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2191, (MTCY190.02), len: 645 aa. Conserved hypothetical protein, similar to SW:DP3A_B ACSU P13267 DNA polymerase III, alpha chain (31.3% identity in 249 aa overlap) and SW:UVRC_ECOLI P07028 excinuclease ABC subunit C (25.7% identity in 230 aa overlap). Also similar to M. tuberculosis Rv3711c (dnaQ DNA polymerase III e chain) and Rv1420 (uvrC excinuclease ABC subunit C)
Molecular mass (Da)69148.1
Isoelectric point9.7382
Gene length (bp)1938
Protein length645
Location (kb)2453.82


Functional categoryinformation pathways


ProteomicsIdentified in the cytosol, cell wall, and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24538192455756+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2191|Rv2191
VQGPNVAAMGATGGTQLSFADLAHAQGAAWTPADEMSLRETTFVVVDLETTGGRTTGNDA
TPPDAITEIGAVKVCGGAVLGEFATLVNPQHSIPPQIVRLTGITTAMVGNAPTIDAVLPM
FFEFAGDSVLVAHNAGFDIGFLRAAARRCDITWPQPQVLCTMRLARRVLSRDEAPSVRLA
ALARLFAVASNPTHRALDDARATVDVLHALIERVGNQGVHTYAELRSYLPNVTQAQRCKR
VLAETLPHRPGVYLFRGPSGEVLYVGTAADLRRRVSQYFNGTDRRKRMTEMVMLASSIDH
VECAHPLEAGVRELRMLSTHAPPYNRRSKFPYRWWWVALTDEAFPRLSVIRAPRHDRVVG
PFRSRSKAAETAALLARCTGLRTCTTRLTRSARHGPACPELEVSACPAARDVTAAQYAEA
VLRAAALIGGLDNAALAAAVQQVTELAERRRYESAARLRDHLATAIEALWHGQRLRALAA
LPELIAAKPDGPREGGYQLAVIRHGQLAAAGRAPRGVPPMPVVDAIRRGAQAILPTPAPL
GGALVEEIALIARWLAEPGVRIVGVSNDAAGLASPVRSAGPWAAWAATARSAQLAGEQLS
RGWQSDLPTEPHPSREQLFGRTGVDCRTGPPQPLLPGRQPFSTAG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ10384


Orthologs/Cross-references
CDC1551MT2247
Gene OntologyDNA binding
DNA-directed DNA polymerase activity
exonuclease activity
intracellular
DNA replication
DNA repair
M. bovisMb2214
M. lepraeML0884
M. marinumMMAR_3235
M. smegmatisMSMEG_4259
UniProtQ10384
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2191


Expression Data
TBDBRv2191


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant