Quick Search

Enter gene name or accession number


Search term: Rv2190c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2190c
Rv numberRv2190c
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2190c, (MTV021.23c, MTCY190.01c), len: 385 aa. Conserved hypothetical protein; similar to other hypothetical mycobacterial proteins, including Rv1477, Rv1478, Rv1566c, Rv0024, that are similar to protein p60 precursors from Listeria e.g. Q018 38|P60_LISSE protein p60 precursor (invasion-associated protein) (524 aa). FASTA scores: gp|Z80233|MTCY10H4_25 (281 aa) opt: 290, E(): 6.9e-05; 37.0% identity in 127 aa overlap and sp|Q01838|P60_LISSE protein P60 precursor (523 aa) opt: 268, E(): 0.00071; 38.5% identity in 104 aa overlap.
Molecular mass (Da)39738.1
Isoelectric point6.7272
Gene length (bp)1158
Protein length385
Location (kb)2452.11


Functional categoryvirulence, detoxification, adaptation


ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24521152453272-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2190c|Rv2190c
LRLDQRWLIARVIMRSAIGFFASFTVSSGVLAANVLADPADDALAKLNELSRQAEQTTEA
LHSAQLDLNEKLAAQRAADQKLADNRTALDAARARLATFQTAVNKVAAATYMGGRTHGMD
AILTAESPQLLIDRLSVQRVMAHQMSTQMARFKAAGEQAVKAEQAAAKSAADARSAAEQA
AAVRANLQHKQSQLQVQIAVVKSQYVALTPEERTALADPGPVPAVAAIAPGAPPAALPPG
APPGDGPAPGVAPPPGGMPGLPFVQPDGAGGDRTAVVQAALTQVGAPYAWGGAAPGGFDC
SGLVMWAFQQAGIALPHSSQALAHGGQPVALSDLQPGDVLTFYSDASHAGIYIGDGLMVH
SSTYGVPVRVVPMDSSGPIYDARRY
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP67473


Orthologs/Cross-references
CDC1551MT2245
M. bovisMb2213c
M. lepraeML0885
M. marinumMMAR_3234
M. smegmatisMSMEG_4256
UniProtP67473
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2190c


Expression Data
TBDBRv2190c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant