Quick Search

Enter gene name or accession number


Search term: Rv2189c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2189c
Rv numberRv2189c
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2189c, (MTV021.22c), len: 257 aa. Conserved hypothetical protein; some similarity to hypothetical protein SC6G10.07c (385 aa) from Streptomyces coelicolor A3(2). Smith-Waterman scores: pir||T35516 hypothetical protein SC6G10.07c - Streptomyces coelicolor >gi|4539203|emb|CAB39861.1| (AL049497) Expect = 2e-08; 30% identity in 245 aa overlap.
Molecular mass (Da)27093.7
Isoelectric point5.5498
Gene length (bp)774
Protein length257
Location (kb)2451.25


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: virulence, detoxification, adaptation (See Mazandu and Mulder, 2012)


TranscriptomemRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24512472452020-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2189c|Rv2189c
VRDGPAAPAQVVAPADGFVALRVADDRTVRLLSLGGAATDRLLSRIAAGIDAAVDEVVAF
WGTDWSHDIFVVAAGSDEQFHAAAGGGLASQWADIAAITVVDRVDPARRTVVGQRIVFAP
GAAHMSPAALRIVLGHELFHYAARADTALDAPRWLAEGVADFVARPKTPPPADAVSVALS
LPSDTDLDTPGPQRSLAYDRAWWFARFVAAAYGTAKLRELYLATCGVGHFDLATAAHDVL
GIDAAGLLARWQRWLMG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2244
M. bovisMb2212c
M. marinumMMAR_3233
M. smegmatisMSMEG_4255
UniProtO53523
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2189c


Expression Data
TBDBRv2189c


Bibliography
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function