Quick Search

Enter gene name or accession number


Search term: Rv2188c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namepimB
Rv numberRv2188c
TypeCDS
FunctionInvolved in lipoarabinomannan (lam) biosynthesis
ProductMannosyltransferase PimB
CommentsRv2188c, (MTV021.21c), len: 385 aa. PimB (previously known as pimB'), mannosyltransferase. Equivalent to Mycobacterium leprae ML0886 putative glycosyl transferase (384 aa). FASTA scores: ML0886 (CAA18697.1| (AL022602) ) opt: 2113, E(): 1.8e-106; 81.462% identity in 383 aa overlap; sptr|P73369|P73369 hypothetical 46.2 kDa protein (404 aa) opt: 379, E(): 2.2e-18; 27.5% identity in 397 aa overlap. Start changed since first submission, now 14 aa shorter.
Molecular mass (Da)41188.1
Isoelectric point9.8441
Gene length (bp)1158
Protein length385
Location (kb)2449.99


Functional categorylipid metabolism


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS24499932451150-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2188c|pimB
VSRVLLVTNDFPPRRGGIQSYLGEFVGRLVGSRAHAMTVYAPQWKGADAFDDAARAAGYR
VVRHPSTVMLPGPTVDVRMRRLIAEHDIETVWFGAAAPLALLAPRARLAGASRVLASTHG
HEVGWSMLPVARSVLRRIGDGTDVVTFVSSYTRSRFASAFGPAASLEYLPPGVDTDRFRP
DPAARAELRKRYRLGERPTVVCLSRLVPRKGQDTLVTALPSIRRRVDGAALVIVGGGPYL
ETLRKLAHDCGVADHVTFTGGVATDELPAHHALADVFAMPCRTRGAGMDVEGLGIVFLEA
SAAGVPVIAGNSGGAPETVQHNKTGLVVDGRSVDRVADAVAELLIDRDRAVAMGAAGREW
VTAQWRWDTLAAKLADFLRGDDAAR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO53522


Orthologs/Cross-references
CDC1551MT2243
Enzyme Classification2.4.1.57
Gene Ontologyphospholipid biosynthetic process
pathogenesis
phosphatidylinositol alpha-mannosyltransferase activity
M. bovisMb2211c
M. lepraeML0886
M. marinumMMAR_3232
M. smegmatisMSMEG_4253
UniProtO53522
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2188c


Expression Data
TBDBRv2188c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Lea-Smith DJ, Martin KL, Pyke JS, Tull D, McConville MJ, Coppel RL, Crellin PK,
Analysis of a new mannosyltransferase required for the synthesis of phosphatidylinositol mannosides and lipoarbinomannan reveals two lipomannan pools in corynebacterineae.
J Biol Chem (2008) 283(11):6773-82
Cited for: Function/Product
Mishra AK, Batt S, Krumbach K, Eggeling L, Besra GS,
Characterization of the Corynebacterium glutamiucm deltapimB' deltamgtA double deletion mutant and the role of Mycobacterium tuberculosis orthologues Rv2188c and Rv0557 in glycolipid biosynthesis.
J Bacteriol (2009) 191(13):4465-72
Cited for: Function/Product
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant