Quick Search

Enter gene name or accession number


Search term: Rv2043c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namepncA
Rv numberRv2043c
TypeCDS
FunctionConverts amides such as nicotinamide to corresponding acid.
ProductPyrazinamidase/nicotinamidase PncA (PZase)
CommentsRv2043c, (MTV018.30c), len: 186 aa. PncA, pyrazinamidase/nicotinamidase (see citations below), involved in susceptibility or resistance to antituberculous drug pyrazinamide.
Molecular mass (Da)19604.6
Isoelectric point4.2182
Gene length (bp)561
Protein length186
Location (kb)2288.68


Functional categoryintermediary metabolism and respiration


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS22886812289241-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2043c|pncA
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSG
TPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMQ50575
Protein Data Bank3GBC 3PL1


Orthologs/Cross-references
CDC1551MT2103
Enzyme Classification3.5.1.-
Gene Ontologymetabolic process
hydrolase activity
M. bovisMb2069c
M. lepraeML1432
M. marinumMMAR_3016
M. smegmatisMSMEG_6506
UniProtQ50575
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2043c
Drug Resistance MutationsPyrazinamide


Expression Data
TBDBRv2043c


Bibliography
Lemaitre N, Callebaut I, Frenois F, Jarlier V, Sougakoff W,
Study of the structure-activity relationships for the pyrazinamidase (PncA) from Mycobacterium tuberculosis
Biochem J (2001) 353(Pt 3):453-8
Cited for: Mutant/Function/Structure
Mestdagh M, Realini L, Fonteyne PA, Rossau R, Jannes G, Mijs W, De Smet KA, Portaels F, Van den Eeckhout E,
Correlation of pncA sequence with pyrazinamide resistance level in BACTEC for 21 mycobacterium tuberculosis clinical isolates
Microb Drug Resist (2000) 6(4):283-7
Cited for: Clinical
Du X, Wang W, Kim R, Yakota H, Nguyen H, Kim SH,
Crystal structure and mechanism of catalysis of a pyrazinamidase from Pyrococcus horikoshii
Biochemistry (2001) 40(47):14166-72
Cited for: Homolog/Structure
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Scorpio A, Zhang Y,
Mutations in pncA, a gene encoding pyrazinamidase nicotinamidase cause resistance to the antituberculous drug pyrazinamide in tubercle bacillus
Nat Med (1996) 2(6):662-7
Cited for: Sequence/Mutant
Scorpio A, Lindholm-Levy P, Heifets L, Gilman R, Siddiqi S, Cynamon M, Zhang Y,
Characterization of pncA mutations in pyrazinamide-resistant Mycobacterium tuberculosis
Antimicrob Agents Chemother (1997) 41(3):540-3
Cited for: Mutant
Sun Z, Scorpio A, Zhang Y,
The pncA gene from naturally pyrazinamide-resistant Mycobacterium avium encodes pyrazinamidase and confers pyrazinamide susceptibility to resistant Mycobacterium tuberculosis complex organisms
Microbiology (1997) 143(Pt 10):3367-73
Cited for: Homolog/Function
Hirano K, Takahashi M, Kazumi Y, Fukasawa Y, Abe C,
Mutation in pncA is a major mechanism of pyrazinamide resistance in Mycobacterium tuberculosis
Tuber Lung Dis (1997) 78(2):117-22
Cited for: Clinical