|  |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation |
| RBS | 2123668 | 2123671 | + | CDS | 2123684 | 2124370 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | Rv1874 MLMRPEPDDDWCARQRAQVADALLGLGVAGLSINVRDSTVRDSLMTLTTLYPPVAAVVSLWTQQCYGEQVAAALRLLAQE CDELGAYLVTESVPLTFPSLVESGSRTPGLANIALLRRPDGLDQATWLTRWQRDHTQVAIEAQATFGYTQNWVVRALTPE APGIAGIVEELFPVAATTDLKAFFGAADDNDLRNRISRMVASTSAFGANQNIDTVPTSRYVFRTPFKD | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT1923 | |
| Mbovis | Mb1905 | |
| Mleprae | ML2040 | |
| Mmarinum | MMAR_2757 | |
| Msmegmatis | MSMEG_3569 | |
| UniProt | O07755 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv1874 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv1874 | |
| Bibliography | ||
|---|---|---|
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 | ||