Quick Search

Enter gene name or accession number


Search term: Rv1603

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehisA
Rv numberRv1603
TypeCDS
FunctionHistidine biosynthesis pathway (fourth step) [catalytic activity: N-(5'-phospho-D-ribosylformimino)-5-amino-1-(5''-phosphoribosyl)-4-imidazolecarb oxamide = N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phosphoribosyl)-4- imidazolecarboxamide.]
ProductProbable phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase HisA
CommentsRv1603, (MTV046.01-MTCY336.01c), len: 245 aa. Probable hisA, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, similar to many e.g. HIS4_STRCO|P16250 phosphoribosylformimino-5-aminoimidaz from Streptomyces coelicolor (240 aa), FASTA scores: opt: 1081, E(): 0, (69.0% identity in 239 aa overlap).
Molecular mass (Da)25730.9
Isoelectric point4.4174
Gene length (bp)738
Protein length245
Location (kb)1803.29


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS18032841803288+
CDS18032941804031+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1603|hisA
VMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGR
GSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGE
HGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGG
PNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQAL
AAVRD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP60578
Protein Data Bank2Y85 2Y88 2Y89


Orthologs/Cross-references
CDC1551MT1639
Enzyme Classification5.3.1.16
5.3.1.24
Gene Ontologyhistidine biosynthetic process
tryptophan biosynthetic process
1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
phosphoribosylanthranilate isomerase activity
cytoplasm
M. bovisMb1629
M. lepraeML1261
M. marinumMMAR_2399
M. smegmatisMSMEG_3209
UniProtP60578
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1603


Expression Data
TBDBRv1603


Bibliography
Barona-Gomez F, Hodgson DA,
Occurrence of a putative ancient-like isomerase involved in histidine and tryptophan biosynthesis.
EMBO Rep (2003) 4(3):296-300
Cited for: Product/Function/Homolog/Secondary
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant