Quick Search

Enter gene name or accession number


Search term: Rv1602

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehisH
Rv numberRv1602
TypeCDS
FunctionHistidine biosynthesis pathway (fifth step). Catalyzes an amidotransferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide ribonucleotide, which is used for purine synthesis.
ProductProbable amidotransferase HisH
CommentsRv1602, (MTCY336.02c), len: 206 aa. Probable hisH, amidotransferase. Similar to many e.g. HIS5_STRCO|P16249 from Streptomyces coelicolor (222 aa), FASTA results: opt: 872, E():0, (61.0% identity in 210 aa overlap). Contains glutamine amidotransferases class-I active site (PS00442). Belongs to the HisH family.
Molecular mass (Da)21386.4
Isoelectric point5.206
Gene length (bp)621
Protein length206
Location (kb)1802.66


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS18026641803284+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1602|hisH
VTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGL
RKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPH
MGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGA
LAATQFHPEKSGDAGAAVLSSWVDGL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO06589


Orthologs/Cross-references
CDC1551MT1638
Enzyme Classification2.4.2.-
Gene Ontologyhistidine biosynthetic process
imidazoleglycerol-phosphate synthase activity
cytoplasm
glutamine metabolic process
M. bovisMb1628
M. lepraeML1260
M. marinumMMAR_2398
M. smegmatisMSMEG_3208
UniProtO06589
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1602


Expression Data
TBDBRv1602


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant