Quick Search

Enter gene name or accession number


Search term: Rv1601

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehisB
Rv numberRv1601
TypeCDS
FunctionHistidine biosynthesis (seventh step) [catalytic activity: D-erythro-1-(imidazol-4-YL)glycerol 3- phosphate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + H(2)O]
ProductProbable imidazole glycerol-phosphate dehydratase HisB
CommentsRv1601, (MTCY336.03c), len: 210 aa. Probable hisB, imidazole glycerol-phosphate dehydratase. Similar to many e.g. HIS7_STRCO|P16247 from Streptomyces coelicolor (197 aa),FASTA results: opt: 763, E(): 0, (57.4% identity in 202 aa overlap). Belongs to the imidazoleglycerol-phosphate dehydratase family.
Molecular mass (Da)22769.6
Isoelectric point6.8512
Gene length (bp)633
Protein length210
Location (kb)1802.04


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS18020261802030+
CDS18020351802667+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1601|hisB
MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDL
TVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSG
RPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITE
AQYKAVARALRQAVEPDPRVSGVPSTKGAL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64368


Orthologs/Cross-references
CDC1551MT1637
Enzyme Classification4.2.1.19
Gene Ontologyhistidine biosynthetic process
imidazoleglycerol-phosphate dehydratase activity
cytoplasm
M. bovisMb1627
M. lepraeML1259
M. marinumMMAR_2397
M. smegmatisMSMEG_3207
UniProtP64368
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1601


Expression Data
TBDBRv1601


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant