Quick Search

Enter gene name or accession number


Search term: Rv1600

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehisC1
Rv numberRv1600
Synonym(s)hisC
TypeCDS
FunctionHistidine biosynthesis (eighth step) [catalytic activity: L-histidinol-phosphate + 2-oxoglutarate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + L-glutamate]
ProductProbable histidinol-phosphate aminotransferase HisC1
CommentsRv1600, (MTCY336.04c), len: 380 aa. Probable hisC1, histidinol-phosphate aminotransferase O06591. Similar to many e.g. HIS8_STRCO|P16246 from Streptomyces coelicolor (369 aa), FASTA results: opt: 1353, E(): 0, (59.0% identity in 356 aa overlap). Some similarity to other Mycobacterium tuberculosis aminotransferases e.g. Rv3772|MTCY13D12.06, FASTA results: E(): 7.4e-25, (33.7% identity in 365 aa overlap). Contains aminotransferases class-II pyridoxal-phosphate attachment site (PS00599). Belongs to class-II of pyridoxal-phosphate-dependent aminotransferases. Note that previously known as hisC.
Molecular mass (Da)40581.1
Isoelectric point5.0752
Gene length (bp)1143
Protein length380
Location (kb)1800.9


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS18008831800887+
CDS18008961802038+
RBS18026541802657+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1600|hisC1
MTRSGHPVTLDDLPLRADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALVDDVVRSVREA
AIDLHRYPDRDAVALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRSA
IGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDRKPDVVFIASPNNPSGQ
SVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGR
LGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLN
DMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVGIPGYLRATTGLAEENDAFLR
ASARIATDLVPVTRSPVGAP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A678


Orthologs/Cross-references
CDC1551MT1636
Enzyme Classification2.6.1.9
Gene Ontologyhistidine biosynthetic process
histidinol-phosphate transaminase activity
pyridoxal phosphate binding
M. bovisMb1626
M. lepraeML1258
M. marinumMMAR_2396
M. smegmatisMSMEG_3206
UniProtP0A678
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1600


Expression Data
TBDBRv1600


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant