Quick Search

Enter gene name or accession number


Search term: Rv1597

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1597
Rv numberRv1597
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv1597, (MTCY336.07c), len: 252 aa. Hypothetical unknown protein.
Molecular mass (Da)27930.6
Isoelectric point6.1639
Gene length (bp)759
Protein length252
Location (kb)1798.29


Functional categoryconserved hypotheticals


ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomemRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS17982941799052+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1597|Rv1597
VARTFEDLVAEAASASVGGWGFSWLDGRATEERPSWGYQRQLSQRLANATAALDLETGGG
EVLAGAGNFPPTMVATEAWPPNAAMATRRLHPLGAVVVITGDKPPLPFADAAFDLVTSRH
PSTRWWTEIARVLRAGGSYFAQHVGPATLWDLREHFLGPREHNGADQYAQVVRTCITDAG
LEIVDLQMERLRVEFFDVGAVIYFLRKVIWFLPDFTVEGYHDRLRALHERIQAEGPFVTY
STRALIEARKPS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO06593


Orthologs/Cross-references
CDC1551MT1633
Gene Ontologymetabolic process
methyltransferase activity
M. bovisMb1623
M. marinumMMAR_0673
UniProtO06593
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1597


Expression Data
TBDBRv1597


Bibliography
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant