Quick Search

Enter gene name or accession number


Search term: Rv1595

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namenadB
Rv numberRv1595
TypeCDS
FunctionQuinolinate biosynthesis. Catalyzes the oxidation of L-aspartate to iminoaspartate which is condensed with dihydroxyacetone phosphate to quinolinate under the action of quinolinate synthase a [catalytic activity: L-aspartate + H(2)O + O(2) = oxaloacetate + NH(3) + H(2)O(2)]
ProductProbable L-aspartate oxidase NadB
CommentsRv1595, (MTCY336.09c), len: 527 aa. Probable nadB, L-aspartate oxidase. Similar to many e.g. Q49617 L-aspartate oxidase (quinolinate synthetase) from Mycobacterium leprae (424 aa), FASTA results: opt: 2152, E(): 0, (82.0% identity in 400 aa overlap). Also shows some similarity to Rv1552 frdA from Mycobacterium tuberculosis (583 aa), FASTA results: E(): 1e-10, (35.3% identity in 566 aa overlap). Heterodimer. The quinolinate synthetase complex consists of the two enzymes quinolinate synthetase a and B.
Molecular mass (Da)53784.8
Isoelectric point6.7104
Gene length (bp)1584
Protein length527
Location (kb)1795.81


Functional categoryintermediary metabolism and respiration


TranscriptomemRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citation below). DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS17958051797388+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1595|nadB
MAGPAWRDAADVVVIGTGVAGLAAALAADRAGRSVVVLSKAAQTHVTATHYAQGGIAVVL
PDNDDSVDAHVADTLAAGAGLCDPDAVYSIVADGYRAVTDLVGAGARLDESVPGRWALTR
EGGHSRRRIVHAGGDATGAEVQRALQDAAGMLDIRTGHVALRVLHDGTAVTGLLVVRPDG
CGIISAPSVILATGGLGHLYSATTNPAGSTGDGIALGLWAGVAVSDLEFIQFHPTMLFAG
RAGGRRPLITEAIRGEGAILVDRQGNSITAGVHPMGDLAPRDVVAAAIDARLKATGDPCV
YLDARGIEGFASRFPTVTASCRAAGIDPVRQPIPVVPGAHYSCGGIVTDVYGQTELLGLY
AAGEVARTGLHGANRLASNSLLEGLVVGGRAGKAAAAHAAAAGRSRATSSATWPEPISYT
ALDRGDLQRAMSRDASMYRAAAGLHRLCDSLSGAQVRDVACRRDFEDVALTLVAQSVTAA
ALARTESRGCHHRAEYPCTVPEQARSIVVRGADDANAVCVQALVAVC
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65499


Orthologs/Cross-references
CDC1551MT1631
Enzyme Classification1.4.3.16
Gene Ontologycytoplasm
L-aspartate oxidase activity
electron carrier activity
NAD biosynthetic process
oxidation reduction
M. bovisMb1621
M. lepraeML1226
M. marinumMMAR_2392
M. smegmatisMSMEG_3200
UniProtP65499
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1595


Expression Data
TBDBRv1595


Bibliography
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Talaat AM, Lyons R, Howard ST, Johnston SA,
The temporal expression profile of Mycobacterium tuberculosis infection in mice.
Proc Natl Acad Sci U S A (2004) 101(13):4602-7
Cited for: Transcriptome
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant