|  |
| To navigate upstream or downstream, click on the first or last gene |
| Functional category | intermediary metabolism and respiration |
| Proteomics | The product of this CDS corresponds to spot 3_302 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutation | essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation |
| RBS | 1615555 | 1615559 | + | CDS | 1615564 | 1616349 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv|Rv1438|tpi VSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG ASLDGEHFATLAAIAAGGPLP | ||
| Blastp: Pre-computed results | ||
| TransMembrane prediction using Hidden Markov Models: TMHMM | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| PFAM | P66940 | |
| Protein Data Bank | 3GVG 3TA6 3TAO | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT1482 | |
| Enzyme Classification | 5.3.1.1 | |
| Gene Ontology | triose-phosphate isomerase activity cytoplasm gluconeogenesis glycolysis pentose-phosphate shunt | |
| M. bovis | Mb1473 | |
| M. leprae | ML0572 | |
| M. marinum | MMAR_2241 | |
| M. smegmatis | MSMEG_3086 | |
| UniProt | P66940 | |
| Multiple Sequences Alignment: between orthologs | ||
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv1438 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv1438 | |
| Bibliography | ||
|---|---|---|
| Mollenkopf HJ, Jungblut PR, Raupach B, Mattow J, Lamer S, Zimny-Arndt U, Zimny -Arndt U, Schaible UE, Kaufmann SH, A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet Electrophoresis (1999) 20(11):2172-80 Cited for: Proteomics | ||
| Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Zimny -Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K, Kaufmann SH, Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens Mol Microbiol (1999) 33(6):1103-17 Cited for: Proteomics | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 Cited for: Mutant | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 Cited for: Proteomics | ||
| Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR, Kaufmann SH, Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Electrophoresis (2003) 24(19-20):3405-20 Cited for: Proteomics | ||
| Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X, Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol Biol Cell (2005) 16(1):396-404 Cited for: Proteomics | ||
| Malen H, Berven FS, Fladmark KE, Wiker HG, Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics (2007) 7(10):1702-18 Cited for: Proteomics | ||
| Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG, Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. BMC Microbiol (2010) 10:132 Cited for: Proteomics | ||
| de Souza GA, Leversen NA, Malen H, Wiker HG, Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. J Proteomics (2011) 75(2):502-10 Cited for: Proteomics | ||
| Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A, Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics (2011) 10(12):M111.011627 Cited for: Proteomics/Sequence | ||
| Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM, High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. PLoS Pathog (2011) 7(9):e1002251 Cited for: Mutant | ||