Quick Search

Enter gene name or accession number


Search term: Rv1268c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1268c
Rv numberRv1268c
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv1268c, (MTCY50.14), len: 232 aa. Hypothetical unknown protein, probably secreted protein : contains possible signal peptide sequence (score 7.9 at residue 28). Predicted to be an outer membrane protein (See Song et al., 2008).
Molecular mass (Da)23973.6
Isoelectric point4.2535
Gene length (bp)699
Protein length232
Location (kb)1417.66


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS14176581418356-
RBS14183631418368-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1268c|Rv1268c
MTTSKIATAFKTATFALAAGAVALGLASPADAAAGTMYGDPAAAAKYWRQQTYDDCVLMS
AADVIGQVTGREPSERAIIKVAQSTPSVVHPGSIYTKPADAEHPNSGMGTSVADIPTLLA
HYGVDAVITDEDHATATGVATGMAALEQYLGSGHAVIVSINAEMIWGQPVEETDSAGNPR
SDHAVVVTGVDTENGIVHLNDSGTPTGRDEQIPMETFVEAWATSHDFMAVTT
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1306
Gene Ontologycysteine-type endopeptidase activity
proteolysis
M. bovisMb1299c
M. marinumMMAR_4154
UniProtP64791
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1268c


Expression Data
TBDBRv1268c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Song H, Sandie R, Wang Y, Andrade-Navarro MA, Niederweis M,
Identification of outer membrane proteins of Mycobacterium tuberculosis.
Tuberculosis (Edinb) (2008) 88(6):526-44
Cited for: Localization
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function