Quick Search

Enter gene name or accession number


Search term: Rv1267c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameembR
Rv numberRv1267c
TypeCDS
FunctionInvolved in transcriptional mechanism. Thought to regulate the biosynthesis of the mycobacterial cell wall arabinan and resistance to ethambutol (EMB; dextro-2,2'-(ethylenediimino)-DI-1-butanol), regulating EMBA|Rv3794 and EMBB|Rv3795.
ProductProbable transcriptional regulatory protein EmbR
CommentsRv1267c, (MT1305, MTCY50.15), len: 388 aa. Probable embR, regulatory protein (see citation below), similar to many e.g. AFSR_STRCO|P25941 regulatory protein AfsR from Streptomyces coelicolor (993 aa), FASTA scores: opt: 489, E(): 1e-25, (33.5% identity in 361 aa overlap); etc. Belongs to the AFSR/DNRI/REDD family of regulators. Phosphorylated in vitro by PknJ|Rv2088 (See Jang et al., 2010).
Molecular mass (Da)41933.5
Isoelectric point7.2329
Gene length (bp)1167
Protein length388
Location (kb)1416.18


Functional categoryregulatory proteins


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS14161811417347-
RBS14173551417359-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1267c|embR
MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALW
EEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKT
AGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEA
EIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLG
IDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRG
YPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSA
VTLNDGDHIRICDHEFTFQISAGTHGGT
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP66799
Protein Data Bank2FEZ 2FF4


Orthologs/Cross-references
CDC1551MT1305
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
intracellular
transcription
regulation of transcription, DNA-dependent
M. bovisMb1298c
M. marinumMMAR_4155
UniProtP66799
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1267c
Drug Resistance MutationsEthambutol


Expression Data
TBDBRv1267c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Alderwick LJ, Molle V, Kremer L, Cozzone AJ, Dafforn TR, Besra GS, Futterer K,
Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2006) 103(8):2558-63
Cited for: Structure
Jang J, Stella A, Boudou F, Levillain F, Darthuy E, Vaubourgeix J, Wang C, Bardou F, Puzo G, Gilleron M, Burlet-Schiltz O, Monsarrat B, Brodin P, Gicquel B, Neyrolles O,
Functional characterization of the Mycobacterium tuberculosis serine/threonine kinase PknJ.
Microbiology (2010) 156(Pt 6):1619-31
Cited for: Biochemistry
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Belanger AE, Besra GS, Ford ME, Mikusova K, Belisle JT, Brennan PJ, Inamine JM,
The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol
Proc Natl Acad Sci U S A (1996) 93(21):11919-24
Cited for: Homolog/Function