Quick Search

Enter gene name or accession number


Search term: Rv1265

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1265
Rv numberRv1265
TypeCDS
FunctionUnknown. Seems to be expressed during macrophage infection.
ProductUnknown protein
CommentsRv1265, (MTCY50.17c), len: 226 aa. Unknown protein (see citation below).
Molecular mass (Da)25229.7
Isoelectric point7.7447
Gene length (bp)681
Protein length226
Location (kb)1413.26


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomemRNA level (identified by real-time quantitative RT-PCR) increased 24h after infection of cultured human macrophages (see citation below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the Cmr|Rv1675c regulon (See Gazdik et al., 2009).


Coordinates
TypeStartEndOrientation
CDS14132601413940+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1265|Rv1265
MVLARPDAVFAPARNRCHVSLPVNAMSLKMKVCNHVIMRHHHMHGRRYGRPGGWQQAQQP
DASGAAEWFAGRLPEDWFDGDPTVIVDREEITVIGKLPGLESPEEESAARASGRVSRFRD
ETRPERMTIADEAQNRYGRKVSWGVEVGGERILFTHIAVPVMTRLKQPERQVLDTLVDAG
VARSRSDALAWSVKLVGEHTEEWLAKLRTAMSAVDDLRAQGPDLPA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1303
M. bovisMb1296
M. lepraeML1112
M. marinumMMAR_4172
M. smegmatisMSMEG_5010
UniProtP64789
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1265


Expression Data
TBDBRv1265


Bibliography
Hobson RJ, Brennan MJ, McBride AJ, Delogu G, Kempsell KE, Dale JW,
Use of an arrayed promoter -probe library for the identification of macrophage -regulated genes in Mycobacterium tuberculosis
Microbiology (2002) 148(Pt 5):1571-9
Cited for: Transcriptome/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Gazdik MA, Bai G, Wu Y, McDonough KA,
Rv1675c (cmr) regulates intramacrophage and cyclic AMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria
Mol Microbiol (2009) 71(2):434-48
Cited for: Regulon
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function