Quick Search

Enter gene name or accession number


Search term: Rv1263

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameamiB2
Rv numberRv1263
TypeCDS
FunctionInvolved in cellular metabolism, active on 2- to 6- carbon aliphatic amides and on many aromatic amides [catalytic activity: a monocarboxylic acid amide + H(2)O = a monocarboxylate + NH(3)].
ProductProbable amidase AmiB2 (aminohydrolase)
CommentsRv1263, (MTCY50.19c), len: 462 aa. Probable amiB2, amidase. Similar to G1001278 hypothetical 54.3 kDa protein (506 aa), FASTA scores: opt: 767, E(): 7.6e-40, (32.8% identity in 461 aa overlap), also similar to G580673 rhodococcus enantiose lective amidase gene (462 aa), FASTA scores, opt: 668, E(): 7.4e-34, (33.5% identity in 484 aa overlap) also to NYLA_PSES8|P13398 6-aminohexanoate-cyclic-dimer hydrolase (492 aa), FASTA scores opt: 543, E(): 3.1e-26, (33.5% identity in 493 aa overlap). Also similar to MTCY274.19c (33.5% identity in 427 aa overlap). Similar to other putative amidases in M. tuberculosis; Rv2363, Rv2888c, etc. Contains PS00017 ATP/GTP-binding site motif A. Belongs to the amidase family.
Molecular mass (Da)49048.9
Isoelectric point7.1831
Gene length (bp)1389
Protein length462
Location (kb)1410.43


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS14104311411819+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1263|amiB2
VDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEA
AQQRLDAGERLPLLGVPIAIKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVII
GKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGSAAAVAAGLAPVALGSDGGGSI
RIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATTTVPGPEGE
FVAAAARQPGRLRIALSTRVPTPLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPAS
TYANYLPRFFRGISDDADAQAHPDRLEARTRAIARLGSFFSDRRMAALRAAEVVLSSRIQ
SIFDDVDVVVTPGAATGPSRIGAYQRRGAVSTLLLVVQRVPYFQVWNLTGQPAAVVPWDF
DGDGLPMSVQLVGRPYDEATLLALAAQIESARPWAHRRPSVS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63492


Orthologs/Cross-references
CDC1551MT1301
Enzyme Classification3.5.1.4
Gene Ontologyamidase activity
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
M. bovisMb1294
M. lepraeML1109
M. marinumMMAR_4176
UniProtP63492
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1263


Expression Data
TBDBRv1263


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Arntzen MO, Fortuin S, Schurch AC, Malen H, McEvoy CR, van Soolingen D, Thiede B, Warren RM, Wiker HG,
Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database.
Mol Cell Proteomics (2011) 10(1):M110.002527
Cited for: Proteomics/Sequence
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant