Quick Search

Enter gene name or accession number


Search term: Rv1240

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namemdh
Rv numberRv1240
TypeCDS
FunctionInvolved in the conversion of malate to oxaloacetate [catalytic activity: (S)-malate + NAD+ = oxaloacetate + NADH].
ProductProbable malate dehydrogenase Mdh
CommentsRv1240, (MTV006.12), len: 329 aa. Probable mdh, Malate dehydrogenase. Most similar to P50917|MDH_MYCLE malate dehydrogenase from Mycobacterium leprae (329 aa), FASTA scores: opt: 1887, E(): 0, (89.1% identity in 329 aa overlap). Contains PS00068 Malate dehydrogenase active site signature. Belongs to the LDH family. MDH subfamily.
Molecular mass (Da)34289.7
Isoelectric point4.3991
Gene length (bp)990
Protein length329
Location (kb)1383.21


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by proteomics (See Rosenkrands et al., 2000). Identified in immunodominant fractions of M. tuberculosis H37Rv cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website
RegulonPredicted to be in the Cmr|Rv1675c regulon (See Gazdik et al., 2009).


Coordinates
TypeStartEndOrientation
RBS13831961383202+
CDS13832131384202+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1240|mdh
VSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDD
CAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAV
AADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIK
KMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSA
ASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLE
IDEFSRGRIDKSTAELADERSAVTELGLI
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A5J6


Orthologs/Cross-references
CDC1551MT1278
Enzyme Classification1.1.1.37
Gene Ontologyglycolysis
tricarboxylic acid cycle
malate metabolic process
L-malate dehydrogenase activity
oxidation reduction
M. bovisMb1272
M. lepraeML1091
M. marinumMMAR_4198
UniProtP0A5J6
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1240


Expression Data
TBDBRv1240


Bibliography
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Covert BA, Spencer JS, Orme IM, Belisle JT,
The application of proteomics in defining the T cell antigens of Mycobacterium tuberculosis.
Proteomics (2001) 1(4):574-86
Cited for: Proteomics
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Mattow J, Siejak F, Hagens K, Becher D, Albrecht D, Krah A, Schmidt F, Jungblut PR, Kaufmann SH, Schaible UE,
Proteins unique to intraphagosomally grown Mycobacterium tuberculosis.
Proteomics (2006) 6(8):2485-94
Cited for: Proteomics
Gazdik MA, Bai G, Wu Y, McDonough KA,
Rv1675c (cmr) regulates intramacrophage and cyclic AMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria
Mol Microbiol (2009) 71(2):434-48
Cited for: Regulon
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics