|  |
| To navigate upstream or downstream, click on the first or last gene |
| Functional category | intermediary metabolism and respiration |
| Proteomics | Identified by proteomics (See Rosenkrands et al., 2000). Identified in immunodominant fractions of M. tuberculosis H37Rv cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
| Regulon | Predicted to be in the Cmr|Rv1675c regulon (See Gazdik et al., 2009). |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation |
| RBS | 1383196 | 1383202 | + | CDS | 1383213 | 1384202 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv|Rv1240|mdh VSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDD CAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAV AADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIK KMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSA ASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLE IDEFSRGRIDKSTAELADERSAVTELGLI | ||
| Blastp: Pre-computed results | ||
| TransMembrane prediction using Hidden Markov Models: TMHMM | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | P0A5J6 | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT1278 | |
| Enzyme Classification | 1.1.1.37 | |
| Gene Ontology | glycolysis tricarboxylic acid cycle malate metabolic process L-malate dehydrogenase activity oxidation reduction | |
| M. bovis | Mb1272 | |
| M. leprae | ML1091 | |
| M. marinum | MMAR_4198 | |
| UniProt | P0A5J6 | |
| Multiple Sequences Alignment: between orthologs | ||
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv1240 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv1240 | |
| Bibliography | ||
|---|---|---|
| Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P, Towards the proteome of Mycobacterium tuberculosis Electrophoresis (2000) 21(17):3740-56 Cited for: Proteomics | ||
| Covert BA, Spencer JS, Orme IM, Belisle JT, The application of proteomics in defining the T cell antigens of Mycobacterium tuberculosis. Proteomics (2001) 1(4):574-86 Cited for: Proteomics | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 Cited for: Mutant | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 Cited for: Proteomics | ||
| Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X, Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol Biol Cell (2005) 16(1):396-404 Cited for: Proteomics | ||
| Mattow J, Siejak F, Hagens K, Becher D, Albrecht D, Krah A, Schmidt F, Jungblut PR, Kaufmann SH, Schaible UE, Proteins unique to intraphagosomally grown Mycobacterium tuberculosis. Proteomics (2006) 6(8):2485-94 Cited for: Proteomics | ||
| Gazdik MA, Bai G, Wu Y, McDonough KA, Rv1675c (cmr) regulates intramacrophage and cyclic AMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria Mol Microbiol (2009) 71(2):434-48 Cited for: Regulon | ||
| Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG, Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. BMC Microbiol (2010) 10:132 Cited for: Proteomics | ||
| de Souza GA, Leversen NA, Malen H, Wiker HG, Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. J Proteomics (2011) 75(2):502-10 Cited for: Proteomics | ||