Quick Search

Enter gene name or accession number


Search term: Rv1083

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1083
Rv numberRv1083
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1083, (MTV017.36), len: 88 aa. Conserved hypothetical protein, similar to U15183|MLU15183_9 hypothetical protein from Mycobacterium leprae (167 aa), FASTA scores: opt: 332, E(): 1.2e-13, (58.4% identity in 101 aa overlap). Hydrophobic domain aa 25-43. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)9263.54
Isoelectric point4.9733
Gene length (bp)267
Protein length88
Location (kb)1207.38


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: virulence, detoxification, adaptation (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS12073831207649+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1083|Rv1083
VNQILLSVIAEGGPGNTGPDFGKASPVGLLVIVLLVIATLFLVRSMNQQLKKVPKSFDRD
HPELDQAADEGTDRDGPARPPGPPHESG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1114
M. bovisMb1112
M. lepraeML2390
M. marinumMMAR_4384
M. smegmatisMSMEG_5260
UniProtO53431
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1083


Expression Data
TBDBRv1083


Bibliography
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function