Quick Search

Enter gene name or accession number


Search term: Rv1081c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1081c
Rv numberRv1081c
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein
CommentsRv1081c, (MTV017.34c), len: 144 aa. Probable conserved membrane protein, with hydrophobic stretch from aa 26 - 48, highly similar to NP_302548.1|NC_002677 conserved membrane protein from Mycobacterium leprae. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted to be an outer membrane protein (See Song et al., 2008).
Molecular mass (Da)15384.7
Isoelectric point11.1354
Gene length (bp)435
Protein length144
Location (kb)1205.98


Functional categorycell wall and cell processes


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS12059841206418-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1081c|Rv1081c
MTHTPIPRPDARYGRPRLSRRARRRVAIALGVLVAAAGIVIAVIGYQRISTSAVTGSLVG
YRLVDDETASVTISVTRSDPSRPVACIVRVRATNGSETGRRELLVPPSEATTVQVTTTVK
SSQPPVMADVYGCGTEVPSYLRLP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1112
M. bovisMb1110c
M. lepraeML2392
M. smegmatisMSMEG_5262
UniProtO53429
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1081c


Expression Data
TBDBRv1081c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
Song H, Sandie R, Wang Y, Andrade-Navarro MA, Niederweis M,
Identification of outer membrane proteins of Mycobacterium tuberculosis.
Tuberculosis (Edinb) (2008) 88(6):526-44
Cited for: Localization
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant