Quick Search

Enter gene name or accession number


Search term: Rv1077

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecbs
Rv numberRv1077
Synonym(s)cysM2
TypeCDS
FunctionThought to be involved in homocysteine transulfuration [catalytic activity: L-serine + L-homocysteine = cystathionine + H2O]
ProductProbable cystathionine beta-synthase Cbs (serine sulfhydrase) (beta-thionase) (hemoprotein H-450)
CommentsRv1077, (MTV017.30), len: 464 aa. Probable cbs (previously cysM2), cystathionine beta-synthase, similar throughout its length to many eukaryotic cystathionine beta-synthases e.g. P32232|CBS_RAT cystathionine beta-synthase (560 aa), FASTA scores: opt: 951, E(): 0, (40.2% identity in 450 aa overlap); also similar in N-terminal domain (aa 1 - 330) to Rv2334|MTCY98.03 CysK Mycobacterium tuberculosis (310 aa), FASTA scores: opt: 855, E(): 0, (46.8% identity in 314 overlap); and other cysteine synthase proteins e.g. Rv1336, Rv0848, etc. Contains PS00217 Sugar transport proteins signature 2 probably spurious. Belongs to the cysteine synthase/cystathionine beta-synthase family.
Molecular mass (Da)48635.2
Isoelectric point4.942
Gene length (bp)1395
Protein length464
Location (kb)1201.72


Functional categoryintermediary metabolism and respiration


ProteomicsThe product of this CDS corresponds to spot 1077 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark), and at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS12017171203111+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1077|cbs
MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVKMIEAAEASGQ
LKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAV
PPHDPASYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKVTHFVAGI
GTGGTITGAGRYLKEVSGGRVRIVGADPEGSVYSGGAGRPYLVEGVGEDFWPAAYDPSVP
DEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPDALIVVLLPDGGRG
YMSKIFNDAWMSSYGFLRSRLDGSTEQSTVGDVLRRKSGALPALVHTHPSETVRDAIGIL
REYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRAKLADAVSAHMSPPLRMIGAG
ELVSAAGKALRDWDALMVVEEGKPVGVITRYDLLGFLSEGAGRR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ7D8W0


Orthologs/Cross-references
CDC1551MT1108
Enzyme Classification4.2.1.22
Gene Ontologycystathionine beta-synthase activity
cytoplasm
cysteine biosynthetic process via cystathionine
pyridoxal phosphate binding
M. bovisMb1106
M. lepraeML2396
M. marinumMMAR_4390
M. smegmatisMSMEG_5270
UniProtQ7D8W0
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1077


Expression Data
TBDBRv1077


Bibliography
Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Zimny -Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K, Kaufmann SH,
Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens
Mol Microbiol (1999) 33(6):1103-17
Cited for: Proteomics
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mattow J, Siejak F, Hagens K, Becher D, Albrecht D, Krah A, Schmidt F, Jungblut PR, Kaufmann SH, Schaible UE,
Proteins unique to intraphagosomally grown Mycobacterium tuberculosis.
Proteomics (2006) 6(8):2485-94
Cited for: Proteomics
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant