Quick Search

Enter gene name or accession number


Search term: Rv1076

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namelipU
Rv numberRv1076
TypeCDS
FunctionHydrolyses lipids
ProductPossible lipase LipU
CommentsRv1076, (MTV017.29), len: 297 aa. Possible lipU, lipase, very similar to several Mycobacterium tuberculosis proteins e.g. Z95390|Rv3487c|MTCY13E12.41c (277 aa), FASTA scores: opt: 1225, E(): 0, (76.0% identity in 246 aa overlap); Rv1426c, etc. Also similar to esterases and lipases of around 300 aa e.g. Q44087 esterase precursor from Acinetobacter lwoffii esterase (303), FASTA scores: opt: 427, E(): 1.9e-21, (32.5% identity in 280 aa overlap). Equivalent to AL035159|MLCB1450 _7 Mycobacterium leprae (335 aa), FASTA scores: opt: 1588, E(): 0, (79.7% identity in 296 aa overlap).
Molecular mass (Da)31649.3
Isoelectric point6.2827
Gene length (bp)894
Protein length297
Location (kb)1200.77


Functional categoryintermediary metabolism and respiration


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).


Coordinates
TypeStartEndOrientation
CDS12007671201660+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1076|lipU
VAVRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQLVRASGVLPAD
GTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVVDYRLIPKHSIGMALDDCHDG
YRWLRLLGYEPEQIVLAGDSAGGYLALALAQRLQEVGEEPAALVAISPLLQLAKEHKQAH
PNIKTDAMFPARAFDALDALVASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEV
LLHDAQLAAAKLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO53424


Orthologs/Cross-references
CDC1551MT1106
Enzyme Classification3.1.-.-
Gene Ontologymetabolic process
hydrolase activity
M. bovisMb1105
M. lepraeML0314
M. marinumMMAR_4391
M. smegmatisMSMEG_5271
UniProtO53424
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1076


Expression Data
TBDBRv1076


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd,
The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice.
Proc Natl Acad Sci U S A (2003) 100(17):10026-31
Cited for: Regulon
Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS, Kolattukudy PE,
A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis.
J Biol Chem (2006) 281(7):3866-75
Cited for: Product/Transcriptome
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant