Quick Search

Enter gene name or accession number


Search term: Rv1075c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1075c
Rv numberRv1075c
TypeCDS
FunctionFunction unknown
ProductConserved exported protein
CommentsRv1075c, (MTV017.28c), len: 314 aa. Possibly exported protein, as it contains a N-terminal signal sequence, hydrophobic domain from aa 7-25. Similar to U15183|MLU15183_2 Mycobacterium leprae cosmid B1740 (106 aa), FASTA scores: opt: 207, E(): 1.6e-06, (42.6% identity in 101 aa overlap). Also weak similarity to many glyceraldehyde-3-phosphate dehydrogenases e.g. Q41595|G3PC_TAXBA Taxus baccata (340 aa), FASTA scores: opt: 147, E(): 0.027, (27.5% identity in 189 aa overlap).
Molecular mass (Da)32847.1
Isoelectric point11.3192
Gene length (bp)945
Protein length314
Location (kb)1199.43


Functional categorycell wall and cell processes


ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomeDNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11994261200370-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1075c|Rv1075c
VPRRSTIALATAGALASTGTAYLGARNLLVGQATHARTVIPKSFDAPPRADGVYTRGGGP
VQRWRREVPFDVHLMIFGDSTATGYGCASAEEVPGVLIARGLAEQTGKRIRLSTKAIVGA
TSKGVCGQVDAMFVVGPPPDAAVIMIGANDITALNGIGPSAQRLADCVRRLRTRGAVVVV
GTCPDLGVITAIPQPLRALAHTRGVRLARAQTAAVKAAGGVPVPLGHLLAPKFRAMPELM
FSADRYHPSAPAYALAADLLFLALRDALTEKLDIPIHETPSRPGTATLEPGHTRHSMMSR
LRRPRPARAVPTGG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO53423


Orthologs/Cross-references
CDC1551MT1105
Gene Ontologylipid metabolic process
hydrolase activity, acting on ester bonds
M. bovisMb1104c
M. lepraeML2398
M. marinumMMAR_4392
M. smegmatisMSMEG_5272
UniProtO53423
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1075c


Expression Data
TBDBRv1075c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant