Quick Search

Enter gene name or accession number


Search term: Rv1036c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1036c
Rv numberRv1036c
TypeCDS
FunctionPossibly required for the transposition of the insertion element IS1560.
ProductProbable IS1560 transposase (fragment)
CommentsRv1036c, (MTCY10G2.13), len: 112 aa. Probable IS1560 transposase fragment, similar to part of Rv3386|E1202304|MTV004.44 (234 aa) (82.8% identity in 87 aa overlap).
Molecular mass (Da)12978
Isoelectric point4.3332
Gene length (bp)339
Protein length112
Location (kb)1160.09


Functional categoryinsertion seqs and phages


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11600951160433-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1036c|Rv1036c
LIPGRMVLNWEDGLNALVAEGIEAIVFRTLGDQCWLWESLLPDEVRRLPEELARVDALLD
DPAFFAPFVPFFDPRRGRPSTPMEVYLQLMFVKFRYRLGYESLCREVADSIT
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
M. bovisMb1065c
UniProtP96365
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1036c


Expression Data
TBDBRv1036c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant