Quick Search

Enter gene name or accession number


Search term: Rv1035c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1035c
Rv numberRv1035c
TypeCDS
FunctionPossibly required for the transposition of the insertion element IS1560.
ProductProbable transposase (fragment)
CommentsRv1035c, (MTCY10G2.14), len: 228 aa. Probable IS1560 transposase fragment, similar to parts of Rv3387|E1202305|MTV004.45 (225 aa) (47.8% identity in 67 aa overlap) and Rv3386|E1202304|MTV004.44 (234 aa) (55.1% identity in 127 aa overlap).
Molecular mass (Da)23943.3
Isoelectric point11.9346
Gene length (bp)687
Protein length228
Location (kb)1159.38


Functional categoryinsertion seqs and phages


ProteomicsIdentified in the cytosol, cell wall, and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11593751160061-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1035c|Rv1035c
VPHPTTLMKLTTRCGSAAIDGLNEALLAKAAEAKLLGTNRIRADTTVARANVSYPTDLGL
LAKAMRRIAATGKRIQAAGGAVRTRVGDRSRAAGRRAHAVAAKLRSRAELGRDEARAAVL
RFTGELAELAQAAAQEAQQLLDNAKQAVLRAKAKAAALAARGERDAVAGRRCGGLVRAVN
DLTELLNATRQIVAQTRQRVAGITSDGASRRVSLHDGDARPDHQGSAR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1065
M. bovisMb1064c
UniProtP96366
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1035c


Expression Data
TBDBRv1035c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics