Quick Search

Enter gene name or accession number


Search term: Rv1034c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1034c
Rv numberRv1034c
TypeCDS
FunctionPossibly required for the transposition of the insertion element IS1560.
ProductProbable transposase (fragment)
CommentsRv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E1202305|MTV004.45 (225 aa) (65.1% identity in 129 aa overlap).
Molecular mass (Da)14254.2
Isoelectric point11.6608
Gene length (bp)390
Protein length129
Location (kb)1158.92


Functional categoryinsertion seqs and phages


MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11589181159307-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1034c|Rv1034c
VQQGNPPDAPQLAPAVAWVKKRAGRTPRTVTADRGYGEAAVDQQLTEVGVKNVLIPRKGK
PSQDRRAEEHRKAFRRTIKWRTGCEGRISHLKRGYGWDRGRIGGLEGTRTWVGHGVFAHN
LVTISALPA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT1063
M. bovisMb1063c
UniProtP96367
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1034c


Expression Data
TBDBRv1034c


Bibliography
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant