Quick Search

Enter gene name or accession number


Search term: Rv1033c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nametrcR
Rv numberRv1033c
TypeCDS
FunctionSensor part of the two component regulatory system TRCS/TRCR. Involved in transcriptional autoactivation: TRCR activates its own expression by interacting with the at-rich sequence of the TRCR promoter.
ProductTwo component transcriptional regulator TrcR
CommentsRv1033c, (MTCY10G2.16), len: 257 aa. TrcR, two-component regulatory protein (see citations below), similar to Q50825 two component response regulator from Mycobacterium tuberculosis (234 aa), FASTA scores: opt: 628, E(): 0, (46.0% identity in 226 aa overlap). Note that in vitro autophosphorylation of TrcS requires the presence of Mn2+or Ca2+as a divalent cation cofactor and subsequent transphosphorylation of TrcR is evident in the presence of TrcS-phosphate and Ca2+.
Molecular mass (Da)29209.4
Isoelectric point6.0621
Gene length (bp)774
Protein length257
Location (kb)1157.96


Functional categoryregulatory proteins


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11579631158736-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1033c|trcR
MTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMALHYEGWDVEV
AHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRESDVYTPTLFLTARDSVMDRVT
GLTSGADDYMTKPFSLEELVARLRGLLRRSSHLERPADEALRVGDLTLDGASREVTRDGT
PISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDRE
PMIHTVRGIGYMLRPPE
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ50806


Orthologs/Cross-references
CDC1551MT1062
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
regulation of transcription, DNA-dependent
M. bovisMb1062c
M. lepraeML0261
M. smegmatisMSMEG_2916
UniProtQ50806
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1033c


Expression Data
TBDBRv1033c


Bibliography
Benjamin Jr WH, Haydel SE, Dunlap NE, Benjamin WH,
In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins
Microb Pathog (1999) 26(4):195-206
Cited for: Product/Regulation/Biochemistry
Benjamin Jr WH, Haydel SE, Benjamin WH, Dunlap NE, Clark-Curtiss JE,
Expression, autoregulation, and DNA binding properties of the Mycobacterium tuberculosis TrcR response regulator
J Bacteriol (2002) 184(8):2192-203
Cited for: Regulation
Ewann F, Jackson M, Pethe K, Cooper A, Mielcarek N, Ensergueix D, Gicquel B, Locht C, Supply P,
Transient requirement of the PrrA-PrrB two-component system for early intracellular multiplication of Mycobacterium tuberculosis
Infect Immun (2002) 70(5):2256-63
Cited for: Mutant
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant